Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TAE3

Protein Details
Accession M2TAE3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-94SLPFFLPGKKGKNKNKTKERVHIRVRKKNBasic
NLS Segment(s)
PositionSequence
73-94GKKGKNKNKTKERVHIRVRKKN
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
KEGG bsc:COCSADRAFT_197670  -  
Amino Acid Sequences THTHTHANYAKHTHPYTYHAHRRPLPAYRPPQRLTRSCLQPAPNKKKTFSPSFPCPLRHYCHLSLSLPFFLPGKKGKNKNKTKERVHIRVRKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.43
4 0.47
5 0.53
6 0.51
7 0.57
8 0.59
9 0.62
10 0.63
11 0.63
12 0.6
13 0.59
14 0.63
15 0.64
16 0.67
17 0.63
18 0.66
19 0.65
20 0.62
21 0.59
22 0.58
23 0.55
24 0.51
25 0.53
26 0.5
27 0.51
28 0.58
29 0.61
30 0.61
31 0.57
32 0.54
33 0.56
34 0.57
35 0.57
36 0.53
37 0.51
38 0.49
39 0.54
40 0.56
41 0.52
42 0.51
43 0.48
44 0.46
45 0.43
46 0.44
47 0.39
48 0.39
49 0.38
50 0.35
51 0.33
52 0.31
53 0.27
54 0.21
55 0.19
56 0.17
57 0.14
58 0.17
59 0.2
60 0.26
61 0.34
62 0.44
63 0.54
64 0.64
65 0.74
66 0.81
67 0.87
68 0.89
69 0.89
70 0.89
71 0.89
72 0.89
73 0.89
74 0.88