Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QXS4

Protein Details
Accession M2QXS4   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
148-171SIIHQRSHKKRNGKLCWHKNDPVNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_mito 9.5, nucl 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_40353  -  
Amino Acid Sequences MDYTTAEKIYGQIVAAIKSKDIEEFDRLVQDNPTWPPQEHWLGHPHDAASRSGLPMFKAFLKHFPQTKDWDCGETGDVVGAAAMTGDIPVLKYCLEELGHNANEGRIFFSPVLYFLDSMKDTTIPGKKAEVIQILEQHGATMEGEPGSIIHQRSHKKRNGKLCWHKNDPVNCPDYVHDENPGVVEQAKKLFGWNKPGSSVETPASESQEKLAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.19
4 0.18
5 0.19
6 0.19
7 0.17
8 0.19
9 0.2
10 0.2
11 0.22
12 0.23
13 0.27
14 0.27
15 0.26
16 0.25
17 0.22
18 0.23
19 0.24
20 0.28
21 0.26
22 0.25
23 0.27
24 0.31
25 0.37
26 0.34
27 0.33
28 0.36
29 0.37
30 0.38
31 0.37
32 0.32
33 0.27
34 0.28
35 0.25
36 0.22
37 0.19
38 0.18
39 0.19
40 0.19
41 0.16
42 0.16
43 0.17
44 0.16
45 0.19
46 0.19
47 0.24
48 0.28
49 0.33
50 0.37
51 0.39
52 0.4
53 0.44
54 0.46
55 0.45
56 0.41
57 0.37
58 0.32
59 0.3
60 0.26
61 0.19
62 0.15
63 0.09
64 0.08
65 0.06
66 0.05
67 0.04
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.04
81 0.06
82 0.06
83 0.06
84 0.09
85 0.14
86 0.14
87 0.14
88 0.14
89 0.13
90 0.13
91 0.13
92 0.12
93 0.07
94 0.09
95 0.08
96 0.09
97 0.09
98 0.09
99 0.11
100 0.09
101 0.09
102 0.08
103 0.1
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.13
110 0.17
111 0.15
112 0.16
113 0.17
114 0.18
115 0.19
116 0.22
117 0.21
118 0.18
119 0.19
120 0.21
121 0.21
122 0.2
123 0.18
124 0.15
125 0.11
126 0.1
127 0.09
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.09
136 0.1
137 0.12
138 0.19
139 0.27
140 0.36
141 0.45
142 0.51
143 0.58
144 0.64
145 0.72
146 0.76
147 0.79
148 0.82
149 0.83
150 0.85
151 0.83
152 0.82
153 0.79
154 0.76
155 0.71
156 0.66
157 0.58
158 0.49
159 0.44
160 0.39
161 0.38
162 0.36
163 0.3
164 0.26
165 0.24
166 0.24
167 0.23
168 0.22
169 0.16
170 0.13
171 0.14
172 0.13
173 0.16
174 0.17
175 0.16
176 0.2
177 0.26
178 0.29
179 0.37
180 0.41
181 0.4
182 0.42
183 0.44
184 0.44
185 0.41
186 0.41
187 0.33
188 0.3
189 0.31
190 0.3
191 0.34
192 0.29
193 0.26
194 0.25