Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2REC7

Protein Details
Accession M2REC7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22MRKHLVKKGAWYRPNRRSTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, E.R. 6, plas 2, cyto 1, extr 1, vacu 1
Family & Domain DBs
KEGG bsc:COCSADRAFT_36435  -  
Amino Acid Sequences MAMRKHLVKKGAWYRPNRRSTTVTTPTLVLLTFVTAFLDVIAPDCSRSIARASHRVRAEHPIVISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.82
4 0.76
5 0.71
6 0.66
7 0.65
8 0.65
9 0.61
10 0.54
11 0.45
12 0.42
13 0.37
14 0.32
15 0.25
16 0.15
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.05
28 0.06
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.1
35 0.11
36 0.16
37 0.21
38 0.31
39 0.34
40 0.41
41 0.45
42 0.47
43 0.47
44 0.5
45 0.48
46 0.42