Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2THZ1

Protein Details
Accession M2THZ1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-69VTSKMYPKKKEAKKGKMLGFIKHydrophilic
NLS Segment(s)
PositionSequence
54-70PKKKEAKKGKMLGFIKR
Subcellular Location(s) plas 14, mito 5, E.R. 5, cyto 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_33697  -  
Amino Acid Sequences MSFSWLAPILTPAALRSVEADGRPVITLFLVIFGLSVLGAVIWYVHFVTSKMYPKKKEAKKGKMLGFIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.13
6 0.13
7 0.15
8 0.12
9 0.13
10 0.13
11 0.11
12 0.09
13 0.07
14 0.07
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.07
36 0.13
37 0.22
38 0.3
39 0.37
40 0.41
41 0.49
42 0.6
43 0.66
44 0.72
45 0.74
46 0.76
47 0.8
48 0.85
49 0.84
50 0.83