Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SC56

Protein Details
Accession M2SC56   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-77SESIRRTGLRNKRGRKPQWRWTEKTGKLHydrophilic
NLS Segment(s)
PositionSequence
58-67LRNKRGRKPQ
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG bsc:COCSADRAFT_356125  -  
Amino Acid Sequences MFWGCFSYDKKGPCHIYQLETKAEKEDAARQIKQLNAELEPLQREEWELSESIRRTGLRNKRGRKPQWRWTEKTGKLVRTSGGGIDWWRYQTCVLIPKLIPFAKKCLQDRPQTVVMEDKAPSHAHHYQSVIYRLHDVERLLWCGNSPDCNCIKPCWFYIKRETTKKGAPQSRAEAVRIWQNCWRDLSQLKIQAWIERILVHIQKIIELQGGNEYIEGRDKPRLRRPYFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.49
4 0.52
5 0.52
6 0.52
7 0.48
8 0.46
9 0.4
10 0.37
11 0.33
12 0.29
13 0.32
14 0.32
15 0.37
16 0.37
17 0.36
18 0.4
19 0.41
20 0.42
21 0.39
22 0.32
23 0.27
24 0.28
25 0.28
26 0.26
27 0.26
28 0.24
29 0.19
30 0.17
31 0.17
32 0.15
33 0.15
34 0.14
35 0.12
36 0.12
37 0.18
38 0.19
39 0.18
40 0.21
41 0.2
42 0.21
43 0.31
44 0.39
45 0.43
46 0.52
47 0.6
48 0.66
49 0.76
50 0.83
51 0.85
52 0.84
53 0.84
54 0.86
55 0.86
56 0.82
57 0.8
58 0.81
59 0.72
60 0.73
61 0.69
62 0.62
63 0.56
64 0.52
65 0.43
66 0.34
67 0.32
68 0.22
69 0.16
70 0.13
71 0.11
72 0.12
73 0.12
74 0.12
75 0.11
76 0.11
77 0.11
78 0.11
79 0.13
80 0.17
81 0.17
82 0.19
83 0.19
84 0.2
85 0.25
86 0.25
87 0.25
88 0.19
89 0.25
90 0.27
91 0.32
92 0.33
93 0.37
94 0.42
95 0.46
96 0.49
97 0.48
98 0.48
99 0.42
100 0.41
101 0.34
102 0.29
103 0.24
104 0.21
105 0.15
106 0.12
107 0.13
108 0.13
109 0.16
110 0.19
111 0.19
112 0.21
113 0.21
114 0.22
115 0.25
116 0.29
117 0.24
118 0.2
119 0.2
120 0.19
121 0.19
122 0.18
123 0.15
124 0.14
125 0.15
126 0.17
127 0.16
128 0.15
129 0.14
130 0.15
131 0.16
132 0.18
133 0.17
134 0.19
135 0.2
136 0.23
137 0.24
138 0.24
139 0.27
140 0.24
141 0.26
142 0.31
143 0.33
144 0.35
145 0.44
146 0.51
147 0.56
148 0.62
149 0.64
150 0.59
151 0.62
152 0.65
153 0.65
154 0.62
155 0.59
156 0.57
157 0.58
158 0.6
159 0.55
160 0.49
161 0.41
162 0.35
163 0.38
164 0.34
165 0.31
166 0.29
167 0.3
168 0.31
169 0.33
170 0.32
171 0.3
172 0.31
173 0.34
174 0.36
175 0.41
176 0.39
177 0.41
178 0.41
179 0.39
180 0.39
181 0.34
182 0.27
183 0.21
184 0.22
185 0.22
186 0.23
187 0.2
188 0.21
189 0.19
190 0.2
191 0.2
192 0.19
193 0.16
194 0.14
195 0.14
196 0.15
197 0.16
198 0.15
199 0.14
200 0.14
201 0.12
202 0.17
203 0.18
204 0.17
205 0.26
206 0.32
207 0.4
208 0.5
209 0.6