Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TIE9

Protein Details
Accession M2TIE9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-63IPLLPRTPKKKASRPPPPQGRGKQSAHydrophilic
NLS Segment(s)
PositionSequence
43-59RTPKKKASRPPPPQGRG
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
KEGG bsc:COCSADRAFT_77110  -  
Amino Acid Sequences MLLFSAPPCDSLLPRGPAKQTVSKRLALPFWSTTPASIPLLPRTPKKKASRPPPPQGRGKQSALQTKPTQMSHHADSSRSSTFAPTLGSIPEVFEYDPLDARHRPASLNDVPETPDAFLPEASIASPPALTRATSWPAIIQAPSRRVASSLAVSKALRRILEADRARRRRIMKAYLKAIVFLKYLWHANERYGHVMATTGMYMQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.41
5 0.45
6 0.49
7 0.49
8 0.53
9 0.55
10 0.54
11 0.55
12 0.53
13 0.51
14 0.44
15 0.42
16 0.36
17 0.33
18 0.34
19 0.3
20 0.26
21 0.25
22 0.26
23 0.22
24 0.21
25 0.21
26 0.22
27 0.29
28 0.32
29 0.38
30 0.42
31 0.47
32 0.54
33 0.61
34 0.66
35 0.69
36 0.76
37 0.8
38 0.83
39 0.86
40 0.88
41 0.85
42 0.85
43 0.83
44 0.8
45 0.76
46 0.7
47 0.64
48 0.6
49 0.62
50 0.55
51 0.54
52 0.47
53 0.45
54 0.45
55 0.41
56 0.37
57 0.32
58 0.35
59 0.31
60 0.35
61 0.32
62 0.28
63 0.28
64 0.3
65 0.26
66 0.22
67 0.19
68 0.14
69 0.14
70 0.13
71 0.13
72 0.09
73 0.09
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.07
81 0.06
82 0.07
83 0.07
84 0.09
85 0.09
86 0.12
87 0.11
88 0.13
89 0.15
90 0.14
91 0.14
92 0.13
93 0.2
94 0.19
95 0.22
96 0.21
97 0.19
98 0.2
99 0.21
100 0.2
101 0.14
102 0.12
103 0.09
104 0.09
105 0.08
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.07
116 0.07
117 0.07
118 0.09
119 0.13
120 0.16
121 0.16
122 0.16
123 0.15
124 0.16
125 0.16
126 0.15
127 0.16
128 0.18
129 0.2
130 0.23
131 0.23
132 0.22
133 0.22
134 0.23
135 0.21
136 0.21
137 0.22
138 0.21
139 0.23
140 0.23
141 0.24
142 0.27
143 0.27
144 0.22
145 0.19
146 0.22
147 0.23
148 0.32
149 0.37
150 0.42
151 0.5
152 0.56
153 0.58
154 0.6
155 0.61
156 0.6
157 0.63
158 0.63
159 0.63
160 0.66
161 0.69
162 0.68
163 0.64
164 0.58
165 0.51
166 0.43
167 0.33
168 0.24
169 0.21
170 0.19
171 0.22
172 0.22
173 0.25
174 0.23
175 0.27
176 0.33
177 0.34
178 0.35
179 0.33
180 0.31
181 0.26
182 0.26
183 0.22
184 0.17
185 0.13