Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RWJ1

Protein Details
Accession M2RWJ1    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
135-158HPPSEPTHKKKRGRPTKAEAQQRABasic
223-243SESSSEKRRRARPQPLELEKLHydrophilic
NLS Segment(s)
PositionSequence
142-151HKKKRGRPTK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG bsc:COCSADRAFT_258730  -  
Amino Acid Sequences MEPSREPPWAEHEKVYLLAEVLKAAQVPSHVLFAFIRDTNIQPRWNDMALPPGRSVRSSQMAFDTLAATYSVPGQDYRRPHLPAPMMYPGPEVPKKRPHQPETSTPVGRLLQPRPPHSYPGEYIPAGPAYPSAVHPPSEPTHKKKRGRPTKAEAQQRAQEAAARGEVYPPPRRGRQSLTGPPEQSPLGPDPRPLDRTTPPTTSSSQAPPVQTPQQQTGVEQGSESSSEKRRRARPQPLELEKLHTPTGMGSPLTYGSGDPSRNQAYSAFTPNSAPLPSSTEVRDRDVRMEGVEETQARTTTPHSFKDTVGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.28
4 0.2
5 0.18
6 0.16
7 0.14
8 0.12
9 0.11
10 0.1
11 0.09
12 0.1
13 0.09
14 0.12
15 0.13
16 0.16
17 0.15
18 0.16
19 0.16
20 0.17
21 0.2
22 0.17
23 0.18
24 0.17
25 0.2
26 0.26
27 0.3
28 0.33
29 0.29
30 0.34
31 0.37
32 0.35
33 0.34
34 0.27
35 0.32
36 0.3
37 0.32
38 0.29
39 0.28
40 0.28
41 0.28
42 0.3
43 0.27
44 0.31
45 0.3
46 0.3
47 0.29
48 0.29
49 0.29
50 0.26
51 0.21
52 0.13
53 0.13
54 0.12
55 0.08
56 0.07
57 0.08
58 0.08
59 0.08
60 0.1
61 0.12
62 0.17
63 0.22
64 0.27
65 0.32
66 0.35
67 0.36
68 0.41
69 0.43
70 0.4
71 0.4
72 0.4
73 0.34
74 0.31
75 0.32
76 0.26
77 0.28
78 0.3
79 0.29
80 0.29
81 0.39
82 0.43
83 0.51
84 0.6
85 0.59
86 0.64
87 0.66
88 0.69
89 0.66
90 0.69
91 0.6
92 0.5
93 0.47
94 0.39
95 0.36
96 0.32
97 0.29
98 0.28
99 0.32
100 0.36
101 0.41
102 0.41
103 0.42
104 0.39
105 0.4
106 0.35
107 0.34
108 0.34
109 0.26
110 0.24
111 0.21
112 0.19
113 0.15
114 0.13
115 0.09
116 0.06
117 0.07
118 0.08
119 0.1
120 0.11
121 0.12
122 0.12
123 0.16
124 0.17
125 0.25
126 0.29
127 0.32
128 0.42
129 0.51
130 0.58
131 0.62
132 0.72
133 0.74
134 0.78
135 0.8
136 0.77
137 0.78
138 0.78
139 0.8
140 0.73
141 0.66
142 0.6
143 0.52
144 0.45
145 0.35
146 0.29
147 0.21
148 0.18
149 0.14
150 0.11
151 0.1
152 0.1
153 0.12
154 0.14
155 0.19
156 0.23
157 0.26
158 0.3
159 0.33
160 0.35
161 0.39
162 0.43
163 0.45
164 0.49
165 0.51
166 0.52
167 0.5
168 0.47
169 0.43
170 0.35
171 0.27
172 0.21
173 0.18
174 0.18
175 0.17
176 0.19
177 0.2
178 0.24
179 0.27
180 0.26
181 0.27
182 0.27
183 0.33
184 0.36
185 0.35
186 0.33
187 0.34
188 0.34
189 0.32
190 0.31
191 0.28
192 0.28
193 0.29
194 0.28
195 0.27
196 0.29
197 0.33
198 0.33
199 0.33
200 0.31
201 0.33
202 0.32
203 0.31
204 0.32
205 0.28
206 0.24
207 0.21
208 0.18
209 0.13
210 0.15
211 0.15
212 0.15
213 0.21
214 0.28
215 0.34
216 0.42
217 0.5
218 0.59
219 0.68
220 0.75
221 0.77
222 0.8
223 0.85
224 0.83
225 0.8
226 0.71
227 0.66
228 0.57
229 0.5
230 0.4
231 0.3
232 0.23
233 0.18
234 0.2
235 0.16
236 0.14
237 0.11
238 0.11
239 0.12
240 0.12
241 0.11
242 0.09
243 0.11
244 0.15
245 0.17
246 0.17
247 0.22
248 0.25
249 0.25
250 0.26
251 0.23
252 0.25
253 0.28
254 0.33
255 0.29
256 0.26
257 0.27
258 0.28
259 0.29
260 0.23
261 0.2
262 0.15
263 0.19
264 0.2
265 0.22
266 0.23
267 0.28
268 0.3
269 0.35
270 0.39
271 0.36
272 0.38
273 0.39
274 0.37
275 0.31
276 0.31
277 0.26
278 0.22
279 0.24
280 0.21
281 0.2
282 0.21
283 0.2
284 0.18
285 0.19
286 0.2
287 0.26
288 0.31
289 0.34
290 0.39
291 0.41