Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TLQ8

Protein Details
Accession M2TLQ8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-48LAACLHKRWRVRQRRKRDALAVSHydrophilic
NLS Segment(s)
PositionSequence
36-41VRQRRK
Subcellular Location(s) mito 9, extr 7, E.R. 3, nucl 2, cyto 2, plas 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_32296  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MIKDRAPTFVMVGALLAILPIGLSILAACLHKRWRVRQRRKRDALAVSGEGLGSGDAGKETAEGDRVPGGAAMMEKGQCFEGEQRSSSRDLVHESSTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.04
14 0.05
15 0.06
16 0.08
17 0.12
18 0.17
19 0.22
20 0.31
21 0.41
22 0.52
23 0.64
24 0.71
25 0.79
26 0.86
27 0.88
28 0.84
29 0.81
30 0.73
31 0.66
32 0.59
33 0.49
34 0.38
35 0.31
36 0.24
37 0.17
38 0.13
39 0.08
40 0.04
41 0.03
42 0.03
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.08
66 0.1
67 0.14
68 0.2
69 0.22
70 0.24
71 0.26
72 0.28
73 0.3
74 0.3
75 0.28
76 0.23
77 0.26
78 0.28
79 0.28