Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T577

Protein Details
Accession M2T577    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21LPSLQPSRPKPPQQSPQSAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 8.5, mito 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_155740  -  
Amino Acid Sequences MLPSLQPSRPKPPQQSPQSAYAQQQRRATHSSQQNISQPSSLPLNPPKPRSQVEAMPPFGPPQTPASFFTPVYDSAVRHPVFFTQNLKKPPFPLPQVTCQGFNPVASGYIMEQRRAEAPGKTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.77
4 0.75
5 0.72
6 0.65
7 0.61
8 0.59
9 0.58
10 0.54
11 0.56
12 0.51
13 0.5
14 0.52
15 0.49
16 0.48
17 0.49
18 0.49
19 0.46
20 0.49
21 0.49
22 0.47
23 0.45
24 0.37
25 0.29
26 0.25
27 0.25
28 0.21
29 0.2
30 0.24
31 0.32
32 0.35
33 0.39
34 0.42
35 0.43
36 0.45
37 0.45
38 0.43
39 0.39
40 0.42
41 0.44
42 0.41
43 0.36
44 0.34
45 0.3
46 0.26
47 0.21
48 0.14
49 0.12
50 0.12
51 0.14
52 0.17
53 0.2
54 0.21
55 0.21
56 0.21
57 0.19
58 0.17
59 0.19
60 0.17
61 0.14
62 0.14
63 0.22
64 0.21
65 0.2
66 0.2
67 0.19
68 0.21
69 0.23
70 0.27
71 0.28
72 0.35
73 0.41
74 0.45
75 0.43
76 0.44
77 0.49
78 0.49
79 0.46
80 0.49
81 0.47
82 0.5
83 0.56
84 0.55
85 0.49
86 0.42
87 0.43
88 0.34
89 0.3
90 0.24
91 0.17
92 0.16
93 0.14
94 0.14
95 0.1
96 0.17
97 0.18
98 0.19
99 0.19
100 0.2
101 0.22
102 0.24
103 0.26
104 0.24