Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2QU70

Protein Details
Accession M2QU70    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11, nucl 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG bsc:COCSADRAFT_103363  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences APAATGGKKQKKKWSKGKVKDKAQHAVVLDKTTNDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEANGQIKKVVGHSKLSIYTRAIGDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.89
4 0.93
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.41
15 0.36
16 0.29
17 0.22
18 0.23
19 0.21
20 0.24
21 0.21
22 0.21
23 0.21
24 0.28
25 0.31
26 0.33
27 0.34
28 0.34
29 0.36
30 0.36
31 0.33
32 0.27
33 0.23
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.12
47 0.14
48 0.15
49 0.16
50 0.17
51 0.16
52 0.15
53 0.16
54 0.14
55 0.12
56 0.1
57 0.13
58 0.16
59 0.17
60 0.17
61 0.16
62 0.15
63 0.14
64 0.14
65 0.16
66 0.19
67 0.2
68 0.25
69 0.27
70 0.31
71 0.36
72 0.38
73 0.37
74 0.31
75 0.33
76 0.29