Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TEV9

Protein Details
Accession M2TEV9    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-55HHQPSQRERGRKRGKSKHPHHPCPYQPBasic
108-133SNPQRTQTPTTPKRKKTGQTRPPKPFHydrophilic
NLS Segment(s)
PositionSequence
35-47RERGRKRGKSKHP
120-126KRKKTGQ
128-128R
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, mito 7, cyto 5.5
Family & Domain DBs
KEGG bsc:COCSADRAFT_288018  -  
Amino Acid Sequences MPVVLGQCAGSANHRCNHTHDTYLIVDAHHQPSQRERGRKRGKSKHPHHPCPYQPFLLPKRRIKGGNSPPIHQQPIFLLLSLPFLSTHAKKNTPRHIPGVSHPSIQPSNPQRTQTPTTPKRKKTGQTRPPKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.37
4 0.43
5 0.41
6 0.38
7 0.34
8 0.34
9 0.32
10 0.33
11 0.27
12 0.2
13 0.2
14 0.2
15 0.23
16 0.21
17 0.21
18 0.2
19 0.26
20 0.36
21 0.4
22 0.46
23 0.47
24 0.56
25 0.66
26 0.74
27 0.78
28 0.79
29 0.83
30 0.84
31 0.88
32 0.88
33 0.88
34 0.89
35 0.85
36 0.83
37 0.79
38 0.76
39 0.72
40 0.62
41 0.53
42 0.51
43 0.52
44 0.53
45 0.53
46 0.5
47 0.5
48 0.52
49 0.53
50 0.48
51 0.51
52 0.51
53 0.53
54 0.5
55 0.48
56 0.48
57 0.49
58 0.48
59 0.37
60 0.28
61 0.19
62 0.22
63 0.21
64 0.15
65 0.12
66 0.1
67 0.12
68 0.11
69 0.11
70 0.06
71 0.07
72 0.11
73 0.13
74 0.19
75 0.22
76 0.29
77 0.35
78 0.44
79 0.53
80 0.58
81 0.6
82 0.59
83 0.59
84 0.55
85 0.54
86 0.54
87 0.46
88 0.4
89 0.36
90 0.36
91 0.33
92 0.31
93 0.34
94 0.33
95 0.4
96 0.42
97 0.46
98 0.43
99 0.49
100 0.55
101 0.54
102 0.58
103 0.59
104 0.66
105 0.73
106 0.76
107 0.78
108 0.81
109 0.82
110 0.82
111 0.84
112 0.83
113 0.84