Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TC04

Protein Details
Accession M2TC04    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKNKNRNRNKNRDKRAKDAGGDBasic
NLS Segment(s)
PositionSequence
5-18KNRNRNKNRDKRAK
Subcellular Location(s) cyto_mito 8, mito 7.5, cyto 7.5, nucl 7, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_35210  -  
Amino Acid Sequences MGKNKNRNRNKNRDKRAKDAGGDDGRTSQTPATNSNRDNTYQTSSNVDKTCGGETKTLVDEQKHTKEPEETGASDVQVAVDPEAPTGTPKAKRDSVISNTSEGPADKIKVAAQVAPRAGWNVRVRRWLWLWWSWPCRLLRWTYRFLIALVRIYWNDQRRVEDVLLTVGLGGSVVFGVYLVVDFLVKHSEELMAVFPAEWFLVRHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.89
4 0.85
5 0.77
6 0.7
7 0.68
8 0.63
9 0.57
10 0.49
11 0.42
12 0.36
13 0.32
14 0.3
15 0.22
16 0.2
17 0.2
18 0.26
19 0.3
20 0.35
21 0.36
22 0.4
23 0.4
24 0.39
25 0.4
26 0.38
27 0.36
28 0.32
29 0.32
30 0.33
31 0.32
32 0.36
33 0.34
34 0.31
35 0.28
36 0.26
37 0.28
38 0.25
39 0.25
40 0.21
41 0.2
42 0.22
43 0.22
44 0.22
45 0.21
46 0.19
47 0.22
48 0.27
49 0.32
50 0.33
51 0.33
52 0.32
53 0.33
54 0.33
55 0.33
56 0.3
57 0.25
58 0.22
59 0.22
60 0.2
61 0.17
62 0.16
63 0.1
64 0.08
65 0.07
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.09
74 0.12
75 0.15
76 0.17
77 0.22
78 0.25
79 0.26
80 0.28
81 0.33
82 0.34
83 0.35
84 0.34
85 0.3
86 0.28
87 0.27
88 0.25
89 0.18
90 0.15
91 0.1
92 0.1
93 0.08
94 0.09
95 0.09
96 0.1
97 0.11
98 0.12
99 0.12
100 0.15
101 0.15
102 0.15
103 0.14
104 0.14
105 0.14
106 0.18
107 0.22
108 0.24
109 0.27
110 0.32
111 0.33
112 0.36
113 0.38
114 0.35
115 0.33
116 0.32
117 0.34
118 0.35
119 0.39
120 0.35
121 0.38
122 0.36
123 0.35
124 0.33
125 0.35
126 0.37
127 0.39
128 0.43
129 0.4
130 0.41
131 0.38
132 0.36
133 0.34
134 0.26
135 0.23
136 0.19
137 0.19
138 0.17
139 0.19
140 0.25
141 0.26
142 0.31
143 0.3
144 0.33
145 0.33
146 0.37
147 0.34
148 0.29
149 0.24
150 0.2
151 0.18
152 0.14
153 0.12
154 0.07
155 0.07
156 0.05
157 0.04
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.05
171 0.08
172 0.08
173 0.09
174 0.09
175 0.1
176 0.1
177 0.11
178 0.12
179 0.1
180 0.1
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09