Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2RDR8

Protein Details
Accession M2RDR8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPKRRGPPSRAPVKRPSKLABasic
NLS Segment(s)
PositionSequence
3-20PKRRGPPSRAPVKRPSKL
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
KEGG bsc:COCSADRAFT_170767  -  
Amino Acid Sequences MPPKRRGPPSRAPVKRPSKLAKENGLTAEQEAEIREAFGLFAVSHPDHEDSKEGVLKRGDVRRCLISLNLAPDKSEVPSILSTIDPLNTGFVSFVPFLSYTAIAIHSKDQGSDEDDEEDEYREESNAEEVKAAYRLFTHGTAGPITLAHLRRVSKELREDVPDDVLKDMILEANGGVKGQGKEAGGVSLEDFESVMKRAGLSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.77
5 0.76
6 0.78
7 0.78
8 0.77
9 0.71
10 0.68
11 0.62
12 0.56
13 0.46
14 0.37
15 0.31
16 0.22
17 0.18
18 0.14
19 0.12
20 0.1
21 0.1
22 0.09
23 0.07
24 0.07
25 0.06
26 0.06
27 0.05
28 0.06
29 0.1
30 0.1
31 0.11
32 0.13
33 0.15
34 0.15
35 0.16
36 0.18
37 0.15
38 0.18
39 0.21
40 0.2
41 0.22
42 0.22
43 0.24
44 0.27
45 0.34
46 0.35
47 0.33
48 0.36
49 0.34
50 0.34
51 0.32
52 0.27
53 0.23
54 0.22
55 0.25
56 0.25
57 0.22
58 0.22
59 0.22
60 0.22
61 0.18
62 0.17
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.09
71 0.09
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.06
88 0.06
89 0.08
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.09
96 0.1
97 0.09
98 0.11
99 0.12
100 0.12
101 0.11
102 0.11
103 0.12
104 0.11
105 0.11
106 0.09
107 0.08
108 0.08
109 0.06
110 0.07
111 0.06
112 0.09
113 0.09
114 0.09
115 0.1
116 0.09
117 0.1
118 0.12
119 0.12
120 0.09
121 0.08
122 0.09
123 0.11
124 0.11
125 0.12
126 0.12
127 0.14
128 0.13
129 0.13
130 0.12
131 0.1
132 0.11
133 0.14
134 0.14
135 0.15
136 0.18
137 0.19
138 0.22
139 0.26
140 0.28
141 0.28
142 0.34
143 0.36
144 0.36
145 0.39
146 0.38
147 0.36
148 0.37
149 0.33
150 0.26
151 0.22
152 0.19
153 0.15
154 0.13
155 0.12
156 0.08
157 0.07
158 0.06
159 0.05
160 0.08
161 0.08
162 0.08
163 0.08
164 0.12
165 0.12
166 0.13
167 0.16
168 0.14
169 0.16
170 0.17
171 0.17
172 0.13
173 0.13
174 0.13
175 0.11
176 0.11
177 0.09
178 0.09
179 0.08
180 0.09
181 0.1
182 0.11
183 0.1
184 0.1