Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SUQ1

Protein Details
Accession M2SUQ1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-73GRSPERSSDAPRQRKKRNRWGDASENKAHydrophilic
NLS Segment(s)
PositionSequence
44-64KRGRSPERSSDAPRQRKKRNR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045071  BBP-like  
IPR032570  SF1-HH  
IPR047086  SF1-HH_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0045131  F:pre-mRNA branch point binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG bsc:COCSADRAFT_243802  -  
Pfam View protein in Pfam  
PF16275  SF1-HH  
Amino Acid Sequences MSWRNQGITGSNNIPLGTRRRFAGGDDDGGYNPSAPAEGLSELKRGRSPERSSDAPRQRKKRNRWGDASENKAAGLMGLPTAIYSAMTTEQLDAYTLHLRIEEITQKLKINDVVPADGDRSPSPPPQYDNFGRRVNTREFRYRKRLEDERHKLVEKAMKTLPNYHPPADYRRPTKTQEKVYVPVNDYPEINFSTKLTPLTPLFSSCSTPAFVLTSLLRLLDVYAHLVAPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.29
5 0.29
6 0.28
7 0.31
8 0.32
9 0.32
10 0.36
11 0.32
12 0.3
13 0.3
14 0.3
15 0.26
16 0.27
17 0.25
18 0.17
19 0.13
20 0.1
21 0.08
22 0.06
23 0.07
24 0.07
25 0.09
26 0.11
27 0.13
28 0.17
29 0.17
30 0.19
31 0.22
32 0.23
33 0.28
34 0.34
35 0.38
36 0.42
37 0.48
38 0.52
39 0.55
40 0.62
41 0.67
42 0.69
43 0.73
44 0.74
45 0.79
46 0.83
47 0.87
48 0.88
49 0.88
50 0.86
51 0.85
52 0.83
53 0.83
54 0.81
55 0.77
56 0.68
57 0.57
58 0.48
59 0.4
60 0.32
61 0.21
62 0.14
63 0.07
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.06
81 0.08
82 0.1
83 0.1
84 0.09
85 0.09
86 0.09
87 0.09
88 0.11
89 0.13
90 0.12
91 0.14
92 0.15
93 0.16
94 0.17
95 0.17
96 0.17
97 0.14
98 0.15
99 0.14
100 0.13
101 0.12
102 0.12
103 0.13
104 0.11
105 0.12
106 0.09
107 0.11
108 0.12
109 0.14
110 0.16
111 0.16
112 0.19
113 0.2
114 0.26
115 0.29
116 0.31
117 0.34
118 0.35
119 0.35
120 0.34
121 0.36
122 0.38
123 0.39
124 0.4
125 0.45
126 0.48
127 0.54
128 0.62
129 0.63
130 0.61
131 0.62
132 0.66
133 0.65
134 0.7
135 0.7
136 0.68
137 0.67
138 0.63
139 0.56
140 0.51
141 0.48
142 0.37
143 0.34
144 0.3
145 0.3
146 0.3
147 0.37
148 0.39
149 0.42
150 0.44
151 0.41
152 0.4
153 0.39
154 0.46
155 0.47
156 0.48
157 0.45
158 0.48
159 0.52
160 0.55
161 0.62
162 0.62
163 0.63
164 0.64
165 0.64
166 0.61
167 0.62
168 0.62
169 0.56
170 0.52
171 0.46
172 0.38
173 0.33
174 0.3
175 0.27
176 0.24
177 0.22
178 0.18
179 0.16
180 0.17
181 0.19
182 0.2
183 0.18
184 0.19
185 0.19
186 0.23
187 0.22
188 0.22
189 0.24
190 0.24
191 0.26
192 0.23
193 0.23
194 0.2
195 0.19
196 0.19
197 0.17
198 0.15
199 0.16
200 0.15
201 0.15
202 0.14
203 0.14
204 0.13
205 0.11
206 0.11
207 0.1
208 0.1
209 0.11
210 0.11
211 0.11