Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2RKF8

Protein Details
Accession M2RKF8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-68VTKAAKGTSKPRRKRKATLEGEERQHydrophilic
NLS Segment(s)
PositionSequence
37-60AKRAEQLVTKAAKGTSKPRRKRKA
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 6
Family & Domain DBs
KEGG bsc:COCSADRAFT_83480  -  
Amino Acid Sequences QFLMQINNKTKTRRLTRAEILGKAKVMGFRELEEARAKRAEQLVTKAAKGTSKPRRKRKATLEGEERQAKSGRQMDVQVKGQVNIQVSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.66
4 0.72
5 0.71
6 0.67
7 0.61
8 0.53
9 0.46
10 0.38
11 0.33
12 0.26
13 0.22
14 0.19
15 0.16
16 0.16
17 0.2
18 0.2
19 0.2
20 0.23
21 0.22
22 0.21
23 0.22
24 0.21
25 0.19
26 0.22
27 0.23
28 0.19
29 0.22
30 0.25
31 0.25
32 0.25
33 0.23
34 0.2
35 0.19
36 0.19
37 0.25
38 0.31
39 0.4
40 0.5
41 0.6
42 0.7
43 0.75
44 0.83
45 0.84
46 0.84
47 0.83
48 0.82
49 0.8
50 0.74
51 0.74
52 0.71
53 0.61
54 0.52
55 0.45
56 0.36
57 0.35
58 0.37
59 0.32
60 0.29
61 0.34
62 0.37
63 0.41
64 0.45
65 0.44
66 0.39
67 0.37
68 0.37
69 0.35
70 0.32