Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SE47

Protein Details
Accession M2SE47    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-89FCLPHKTKTIKQPPSPPRPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 9, plas 2, cyto 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
KEGG bsc:COCSADRAFT_170023  -  
Amino Acid Sequences MDMLVSVVIGTSICLVFLVWLTASATLARSAKPHPTSIPTRSHSTPYKATLLRLLATASQPPPNNKPSFCLPHKTKTIKQPPSPPRPSSLPSHPLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.05
7 0.06
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.09
14 0.1
15 0.1
16 0.12
17 0.14
18 0.21
19 0.23
20 0.24
21 0.24
22 0.29
23 0.34
24 0.37
25 0.42
26 0.38
27 0.41
28 0.4
29 0.43
30 0.41
31 0.4
32 0.38
33 0.33
34 0.35
35 0.31
36 0.3
37 0.27
38 0.25
39 0.21
40 0.18
41 0.15
42 0.11
43 0.11
44 0.13
45 0.12
46 0.15
47 0.17
48 0.21
49 0.25
50 0.31
51 0.34
52 0.32
53 0.34
54 0.36
55 0.43
56 0.43
57 0.48
58 0.46
59 0.5
60 0.59
61 0.63
62 0.62
63 0.65
64 0.72
65 0.72
66 0.75
67 0.77
68 0.79
69 0.82
70 0.84
71 0.76
72 0.7
73 0.67
74 0.63
75 0.6
76 0.59
77 0.56