Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2S8H0

Protein Details
Accession M2S8H0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MQRHYRWQRQRKKGRERERETAKKPKVRBasic
NLS Segment(s)
PositionSequence
9-26RQRKKGRERERETAKKPK
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 7.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bsc:COCSADRAFT_329824  -  
Amino Acid Sequences MQRHYRWQRQRKKGRERERETAKKPKVRVTYIVCIWVTSYLSYLTGPPPFPSHHITTLPFPGSKQKVSMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.9
5 0.9
6 0.89
7 0.85
8 0.85
9 0.82
10 0.78
11 0.72
12 0.71
13 0.67
14 0.6
15 0.6
16 0.56
17 0.53
18 0.47
19 0.48
20 0.39
21 0.32
22 0.29
23 0.22
24 0.16
25 0.1
26 0.1
27 0.06
28 0.07
29 0.07
30 0.07
31 0.09
32 0.11
33 0.11
34 0.12
35 0.14
36 0.15
37 0.19
38 0.23
39 0.25
40 0.27
41 0.29
42 0.31
43 0.32
44 0.36
45 0.35
46 0.3
47 0.27
48 0.33
49 0.35
50 0.34
51 0.34