Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TCZ3

Protein Details
Accession M2TCZ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-88LAARSNNNNKKKKDKKPKKPKKPKKPKKPKGRYSGSDNDTBasic
NLS Segment(s)
PositionSequence
57-80NKKKKDKKPKKPKKPKKPKKPKGR
Subcellular Location(s) mito 13, extr 7, cyto_mito 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_35125  -  
Amino Acid Sequences MKFIIPTLLLATLATATPSSPFTDASIEQCNEALTARAAHTYTDAHSHLAARSNNNNKKKKDKKPKKPKKPKKPKKPKGRYSGSDNDTETESAAMMRFVPSMGALQVGVMGFGVLEVVRLWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.07
5 0.09
6 0.1
7 0.1
8 0.11
9 0.12
10 0.15
11 0.16
12 0.18
13 0.23
14 0.22
15 0.21
16 0.21
17 0.19
18 0.16
19 0.15
20 0.13
21 0.07
22 0.08
23 0.08
24 0.1
25 0.1
26 0.09
27 0.1
28 0.1
29 0.1
30 0.13
31 0.13
32 0.12
33 0.12
34 0.13
35 0.13
36 0.18
37 0.19
38 0.18
39 0.25
40 0.35
41 0.42
42 0.51
43 0.58
44 0.56
45 0.66
46 0.72
47 0.76
48 0.77
49 0.81
50 0.83
51 0.87
52 0.94
53 0.95
54 0.96
55 0.97
56 0.97
57 0.97
58 0.97
59 0.97
60 0.97
61 0.96
62 0.96
63 0.96
64 0.94
65 0.93
66 0.91
67 0.84
68 0.81
69 0.8
70 0.72
71 0.64
72 0.55
73 0.46
74 0.38
75 0.33
76 0.25
77 0.15
78 0.12
79 0.09
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03