Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DK22

Protein Details
Accession B0DK22    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTNHNQSKKAHRNGIKKPKSNRSRSLKHydrophilic
NLS Segment(s)
PositionSequence
14-54KKAHRNGIKKPKSNRSRSLKGVDAKFRRNARHALAGSNKAR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lbc:LACBIDRAFT_303686  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSKKAHRNGIKKPKSNRSRSLKGVDAKFRRNARHALAGSNKARLAAKTAAASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.76
5 0.76
6 0.78
7 0.85
8 0.83
9 0.81
10 0.81
11 0.83
12 0.84
13 0.82
14 0.81
15 0.79
16 0.76
17 0.73
18 0.69
19 0.64
20 0.6
21 0.57
22 0.57
23 0.53
24 0.5
25 0.52
26 0.53
27 0.51
28 0.49
29 0.48
30 0.44
31 0.47
32 0.44
33 0.43
34 0.44
35 0.48
36 0.46
37 0.45
38 0.41
39 0.34
40 0.34
41 0.28
42 0.28
43 0.23
44 0.24