Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PDF2

Protein Details
Accession N1PDF2    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-72CRERLHRMRTVCNKKWRTKDNEEKLYLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_mito 8.333, cyto_pero 7.833, mito 6.5, pero 5.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MQKCARSMEQRFGVFLYQLKDKTLRPGADYSNPKDLDRNGIFVLCRERLHRMRTVCNKKWRTKDNEEKLYLEIGFQYCCSFTKKPGLQWLKAKYGDRLGLPLVIWLKSPLRFSIAHHVHGGGILTGGRSKEPKDVKERMFDENNMLMESWYWNSSKVDMAEEYYGELQKTLSAARITDTNIYHSGSMPAAVPGVKMATGELKEDIVDQFTGSAFGSLTDVDDDVPAGPGPVVMAGSVATVSGAAASEAADQGEGVANQEQGGELLENGGVSNMDNGTDDTNVTAAADALGLLGAATFDQAALDDDNFAQEIANPFNTIISNTYGELYVNEMLQFAIQYDQSLRTNLANLQSAANEKDADKFRDVLDDINEEHVSQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.27
4 0.26
5 0.26
6 0.29
7 0.31
8 0.31
9 0.38
10 0.43
11 0.41
12 0.39
13 0.43
14 0.45
15 0.51
16 0.57
17 0.53
18 0.54
19 0.53
20 0.5
21 0.48
22 0.45
23 0.45
24 0.39
25 0.38
26 0.3
27 0.31
28 0.3
29 0.29
30 0.34
31 0.27
32 0.27
33 0.26
34 0.34
35 0.38
36 0.43
37 0.47
38 0.46
39 0.53
40 0.62
41 0.7
42 0.7
43 0.75
44 0.79
45 0.81
46 0.86
47 0.85
48 0.84
49 0.84
50 0.86
51 0.86
52 0.86
53 0.8
54 0.72
55 0.64
56 0.57
57 0.46
58 0.35
59 0.27
60 0.18
61 0.15
62 0.14
63 0.13
64 0.11
65 0.13
66 0.18
67 0.17
68 0.2
69 0.3
70 0.34
71 0.38
72 0.48
73 0.54
74 0.54
75 0.6
76 0.63
77 0.6
78 0.61
79 0.58
80 0.5
81 0.48
82 0.45
83 0.37
84 0.33
85 0.26
86 0.22
87 0.2
88 0.2
89 0.16
90 0.14
91 0.13
92 0.13
93 0.15
94 0.17
95 0.18
96 0.16
97 0.18
98 0.18
99 0.21
100 0.3
101 0.3
102 0.3
103 0.29
104 0.29
105 0.25
106 0.25
107 0.22
108 0.11
109 0.08
110 0.06
111 0.05
112 0.07
113 0.07
114 0.08
115 0.09
116 0.1
117 0.18
118 0.23
119 0.28
120 0.35
121 0.43
122 0.45
123 0.51
124 0.53
125 0.51
126 0.49
127 0.44
128 0.4
129 0.34
130 0.32
131 0.24
132 0.21
133 0.15
134 0.12
135 0.13
136 0.1
137 0.09
138 0.08
139 0.09
140 0.1
141 0.11
142 0.12
143 0.12
144 0.12
145 0.11
146 0.13
147 0.12
148 0.11
149 0.11
150 0.1
151 0.1
152 0.08
153 0.08
154 0.06
155 0.06
156 0.07
157 0.06
158 0.08
159 0.07
160 0.08
161 0.08
162 0.09
163 0.1
164 0.13
165 0.13
166 0.14
167 0.14
168 0.15
169 0.14
170 0.13
171 0.13
172 0.1
173 0.1
174 0.07
175 0.06
176 0.06
177 0.06
178 0.05
179 0.04
180 0.05
181 0.04
182 0.04
183 0.04
184 0.06
185 0.06
186 0.07
187 0.07
188 0.07
189 0.07
190 0.08
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.05
197 0.06
198 0.05
199 0.05
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.02
231 0.03
232 0.03
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.05
240 0.05
241 0.06
242 0.06
243 0.07
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.05
250 0.04
251 0.05
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.06
262 0.06
263 0.07
264 0.08
265 0.08
266 0.07
267 0.07
268 0.07
269 0.06
270 0.05
271 0.04
272 0.04
273 0.04
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.02
280 0.02
281 0.02
282 0.03
283 0.02
284 0.03
285 0.03
286 0.03
287 0.05
288 0.06
289 0.06
290 0.07
291 0.07
292 0.08
293 0.08
294 0.08
295 0.07
296 0.08
297 0.1
298 0.12
299 0.13
300 0.13
301 0.13
302 0.14
303 0.14
304 0.13
305 0.13
306 0.13
307 0.14
308 0.14
309 0.15
310 0.14
311 0.14
312 0.13
313 0.14
314 0.12
315 0.11
316 0.11
317 0.1
318 0.1
319 0.1
320 0.09
321 0.07
322 0.08
323 0.07
324 0.09
325 0.11
326 0.15
327 0.16
328 0.18
329 0.19
330 0.18
331 0.21
332 0.23
333 0.25
334 0.24
335 0.24
336 0.24
337 0.24
338 0.26
339 0.25
340 0.24
341 0.21
342 0.18
343 0.24
344 0.29
345 0.32
346 0.32
347 0.32
348 0.3
349 0.36
350 0.36
351 0.32
352 0.29
353 0.28
354 0.26
355 0.3
356 0.29
357 0.22