FuNGI

N1PWU6

Protein Details

Accession

N1PWU6

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
17-39	LSPAELKKRAKAEKQARRAAQKE	Hydrophilic
71-91	GGPAQQKPKGEKQQQQQPKGA	Hydrophilic

NLS Segment(s)

Position	Sequence
23-36	KKRAKAEKQARRAA

Subcellular Location(s)

nucl 11.5, cyto_nucl 11.333, cyto 9, mito_nucl 6.666, pero 6

Family & Domain DBs

InterPro	View protein in InterPro IPR000649 IF-2B-related IPR042529 IF_2B-like_C IPR037171 NagB/RpiA_transferase-like
Gene Ontology	GO:0005851 C:eukaryotic translation initiation factor 2B complex GO:0032045 C:guanyl-nucleotide exchange factor complex GO:0005085 F:guanyl-nucleotide exchange factor activity GO:0003743 F:translation initiation factor activity GO:0002183 P:cytoplasmic translational initiation GO:0043547 P:positive regulation of GTPase activity GO:0006446 P:regulation of translational initiation
Pfam	View protein in Pfam PF01008 IF-2B

Amino Acid Sequences

MTEQQKPEQPAAEEQKLSPAELKKRAKAEKQARRAAQKEQTGAPAGGPPAEEAATNGEPKLSKQGGGGGGGGPAQQKPKGEKQQQQQPKGAQKQGDQGKNQGGAEQASLPVRNRRGSQSAPKESVTRQENKQVELFSHLYNQPRRQTLEGISKDVHPAVLALGFQMSSYEICGSSARCVAMLLAFKEAIQEYTTPAGTSLARHLTSHYLSPQIDFLKSCRPISESMGNAIRWLKKLIVEVDPDVPEHEAKDQLWNDIDRFIMERITATDQAIASSASGLIKDGSVVLTYAKSSIVEKTILQAHAVGTKFRVVVVDSRPLFEGKNLATSLMNAGLQVEYYAFAGLARAVSDATLVLLGAHSMLSNGRLQARIGAASLAAAAHRVDIPVIVCCGSVKFSGKVALDSIVINEVAPAEELLLPAKTQLSIPTAKDAKNDEGEETKLKSLHDWKDIHNLQILNLMYDITPAEYIRMVICEYGSVPPSSVPVVHRLANEGI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.43
2	0.48
3	0.44
4	0.42
5	0.39
6	0.38
7	0.4
8	0.49
9	0.56
10	0.55
11	0.63
12	0.71
13	0.73
14	0.77
15	0.79
16	0.8
17	0.82
18	0.85
19	0.84
20	0.84
21	0.8
22	0.78
23	0.76
24	0.72
25	0.66
26	0.59
27	0.56
28	0.49
29	0.46
30	0.37
31	0.31
32	0.25
33	0.21
34	0.19
35	0.15
36	0.13
37	0.13
38	0.12
39	0.09
40	0.15
41	0.16
42	0.17
43	0.16
44	0.17
45	0.17
46	0.19
47	0.27
48	0.22
49	0.21
50	0.21
51	0.27
52	0.26
53	0.27
54	0.26
55	0.18
56	0.17
57	0.16
58	0.16
59	0.12
60	0.12
61	0.14
62	0.16
63	0.19
64	0.26
65	0.36
66	0.45
67	0.53
68	0.6
69	0.66
70	0.75
71	0.81
72	0.81
73	0.77
74	0.75
75	0.76
76	0.76
77	0.72
78	0.65
79	0.59
80	0.61
81	0.63
82	0.62
83	0.54
84	0.5
85	0.5
86	0.49
87	0.45
88	0.38
89	0.3
90	0.24
91	0.23
92	0.19
93	0.16
94	0.14
95	0.16
96	0.17
97	0.22
98	0.26
99	0.28
100	0.3
101	0.34
102	0.38
103	0.43
104	0.51
105	0.55
106	0.58
107	0.57
108	0.56
109	0.54
110	0.49
111	0.51
112	0.47
113	0.42
114	0.38
115	0.44
116	0.45
117	0.44
118	0.46
119	0.38
120	0.33
121	0.32
122	0.31
123	0.23
124	0.25
125	0.26
126	0.3
127	0.35
128	0.41
129	0.4
130	0.42
131	0.45
132	0.42
133	0.43
134	0.42
135	0.46
136	0.42
137	0.4
138	0.37
139	0.34
140	0.33
141	0.3
142	0.23
143	0.13
144	0.11
145	0.08
146	0.07
147	0.06
148	0.05
149	0.05
150	0.05
151	0.05
152	0.05
153	0.05
154	0.04
155	0.05
156	0.06
157	0.06
158	0.07
159	0.08
160	0.08
161	0.09
162	0.11
163	0.1
164	0.1
165	0.1
166	0.09
167	0.11
168	0.12
169	0.11
170	0.11
171	0.11
172	0.1
173	0.12
174	0.12
175	0.1
176	0.08
177	0.08
178	0.08
179	0.1
180	0.1
181	0.09
182	0.09
183	0.1
184	0.09
185	0.1
186	0.11
187	0.13
188	0.13
189	0.14
190	0.15
191	0.17
192	0.18
193	0.18
194	0.16
195	0.17
196	0.16
197	0.17
198	0.18
199	0.16
200	0.16
201	0.15
202	0.15
203	0.19
204	0.22
205	0.22
206	0.2
207	0.2
208	0.21
209	0.26
210	0.29
211	0.21
212	0.22
213	0.25
214	0.24
215	0.23
216	0.24
217	0.21
218	0.17
219	0.17
220	0.15
221	0.14
222	0.16
223	0.18
224	0.17
225	0.17
226	0.18
227	0.19
228	0.19
229	0.17
230	0.15
231	0.13
232	0.1
233	0.09
234	0.09
235	0.08
236	0.08
237	0.13
238	0.13
239	0.14
240	0.15
241	0.15
242	0.15
243	0.14
244	0.14
245	0.09
246	0.09
247	0.09
248	0.08
249	0.07
250	0.07
251	0.08
252	0.11
253	0.11
254	0.1
255	0.11
256	0.11
257	0.11
258	0.11
259	0.09
260	0.06
261	0.05
262	0.06
263	0.04
264	0.04
265	0.04
266	0.04
267	0.04
268	0.04
269	0.04
270	0.04
271	0.04
272	0.04
273	0.05
274	0.05
275	0.05
276	0.05
277	0.05
278	0.06
279	0.06
280	0.08
281	0.09
282	0.1
283	0.1
284	0.12
285	0.16
286	0.15
287	0.15
288	0.14
289	0.13
290	0.16
291	0.17
292	0.15
293	0.11
294	0.13
295	0.12
296	0.12
297	0.12
298	0.08
299	0.13
300	0.15
301	0.23
302	0.22
303	0.23
304	0.23
305	0.23
306	0.23
307	0.19
308	0.19
309	0.12
310	0.16
311	0.15
312	0.15
313	0.14
314	0.14
315	0.15
316	0.12
317	0.11
318	0.07
319	0.08
320	0.07
321	0.06
322	0.06
323	0.05
324	0.04
325	0.05
326	0.05
327	0.04
328	0.04
329	0.04
330	0.05
331	0.05
332	0.04
333	0.04
334	0.04
335	0.04
336	0.05
337	0.04
338	0.04
339	0.04
340	0.04
341	0.03
342	0.03
343	0.03
344	0.03
345	0.03
346	0.03
347	0.03
348	0.04
349	0.06
350	0.07
351	0.09
352	0.11
353	0.11
354	0.12
355	0.14
356	0.15
357	0.14
358	0.13
359	0.12
360	0.1
361	0.09
362	0.09
363	0.06
364	0.05
365	0.05
366	0.04
367	0.05
368	0.06
369	0.06
370	0.06
371	0.07
372	0.08
373	0.08
374	0.09
375	0.08
376	0.08
377	0.08
378	0.09
379	0.1
380	0.12
381	0.14
382	0.15
383	0.16
384	0.21
385	0.21
386	0.22
387	0.21
388	0.2
389	0.17
390	0.16
391	0.15
392	0.11
393	0.11
394	0.09
395	0.08
396	0.07
397	0.07
398	0.07
399	0.06
400	0.06
401	0.07
402	0.07
403	0.08
404	0.08
405	0.08
406	0.08
407	0.09
408	0.08
409	0.08
410	0.11
411	0.15
412	0.18
413	0.2
414	0.28
415	0.32
416	0.32
417	0.36
418	0.38
419	0.39
420	0.4
421	0.4
422	0.35
423	0.33
424	0.35
425	0.35
426	0.33
427	0.31
428	0.27
429	0.26
430	0.29
431	0.34
432	0.38
433	0.43
434	0.43
435	0.44
436	0.53
437	0.55
438	0.51
439	0.48
440	0.41
441	0.33
442	0.36
443	0.33
444	0.23
445	0.21
446	0.19
447	0.13
448	0.14
449	0.13
450	0.08
451	0.09
452	0.08
453	0.1
454	0.1
455	0.1
456	0.11
457	0.12
458	0.11
459	0.11
460	0.11
461	0.1
462	0.11
463	0.14
464	0.16
465	0.15
466	0.15
467	0.15
468	0.17
469	0.17
470	0.19
471	0.17
472	0.21
473	0.24
474	0.27
475	0.27

N1PWU6

3D AlphaFold-predicted Structure Viewer