Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PCL0

Protein Details
Accession N1PCL0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-23TTLRHRSMPPSNRLRREPRLSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036881  Glyco_hydro_3_C_sf  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MTTLRHRSMPPSNRLRREPRLSDDSPIRQRLNTDGMISYYDYPLGTDLDSTVGLVLSGTVTLKTLKGKIRRILYIKYYLGLFSKPYTPEDIDATAITGMHVPLTLKATRKSILLLEDKNYTLPLNTRDSKLKKMALIGLSSDMLNFGDYSGQFGQHPSVSSSTLRQGFISTLQAANYSMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.81
4 0.81
5 0.78
6 0.75
7 0.73
8 0.67
9 0.65
10 0.64
11 0.64
12 0.62
13 0.61
14 0.55
15 0.47
16 0.47
17 0.45
18 0.42
19 0.34
20 0.29
21 0.23
22 0.22
23 0.23
24 0.22
25 0.19
26 0.14
27 0.13
28 0.11
29 0.1
30 0.1
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.05
49 0.06
50 0.08
51 0.13
52 0.19
53 0.26
54 0.33
55 0.38
56 0.42
57 0.47
58 0.49
59 0.49
60 0.46
61 0.45
62 0.39
63 0.34
64 0.29
65 0.24
66 0.21
67 0.17
68 0.14
69 0.09
70 0.12
71 0.12
72 0.13
73 0.15
74 0.15
75 0.16
76 0.16
77 0.15
78 0.13
79 0.12
80 0.11
81 0.08
82 0.07
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.08
91 0.1
92 0.12
93 0.14
94 0.17
95 0.17
96 0.18
97 0.18
98 0.17
99 0.2
100 0.22
101 0.22
102 0.22
103 0.23
104 0.23
105 0.22
106 0.21
107 0.16
108 0.12
109 0.13
110 0.15
111 0.19
112 0.21
113 0.24
114 0.32
115 0.35
116 0.41
117 0.44
118 0.43
119 0.38
120 0.38
121 0.41
122 0.34
123 0.32
124 0.27
125 0.23
126 0.2
127 0.18
128 0.15
129 0.11
130 0.09
131 0.08
132 0.07
133 0.06
134 0.08
135 0.08
136 0.12
137 0.13
138 0.13
139 0.13
140 0.14
141 0.17
142 0.16
143 0.17
144 0.15
145 0.16
146 0.18
147 0.19
148 0.21
149 0.26
150 0.28
151 0.27
152 0.25
153 0.25
154 0.24
155 0.25
156 0.26
157 0.21
158 0.18
159 0.18
160 0.19