Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2YLP9

Protein Details
Accession M2YLP9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-34MSKLAISYSPKKDKSKRRTCPSLPNEIWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSLDSAMSKLAISYSPKKDKSKRRTCPSLPNEIWSGIGKLVVDNDSDFTSKDLRKLDWKLDTQVYEPPITKVCRYLRKELLIYYYQTRVNVSMGVYDRNSGHRSLDQVRLVGRDLRIVGPENRKHIGHVTLCWTVDRIRRRKEQALLRFGKRALGFVEDAWDLKVKLELVRVENGGQRDRRTYFYFKVVLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.5
4 0.6
5 0.68
6 0.76
7 0.81
8 0.84
9 0.85
10 0.86
11 0.9
12 0.87
13 0.89
14 0.84
15 0.84
16 0.74
17 0.67
18 0.59
19 0.49
20 0.44
21 0.33
22 0.28
23 0.17
24 0.16
25 0.12
26 0.1
27 0.11
28 0.1
29 0.1
30 0.09
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.16
37 0.16
38 0.2
39 0.21
40 0.22
41 0.29
42 0.33
43 0.37
44 0.38
45 0.4
46 0.4
47 0.41
48 0.4
49 0.34
50 0.34
51 0.3
52 0.25
53 0.23
54 0.2
55 0.21
56 0.21
57 0.21
58 0.24
59 0.29
60 0.36
61 0.4
62 0.46
63 0.47
64 0.5
65 0.5
66 0.45
67 0.42
68 0.35
69 0.32
70 0.27
71 0.24
72 0.21
73 0.2
74 0.19
75 0.15
76 0.14
77 0.13
78 0.11
79 0.11
80 0.1
81 0.12
82 0.11
83 0.11
84 0.11
85 0.13
86 0.15
87 0.12
88 0.13
89 0.12
90 0.16
91 0.19
92 0.23
93 0.21
94 0.21
95 0.21
96 0.21
97 0.21
98 0.2
99 0.17
100 0.13
101 0.13
102 0.13
103 0.13
104 0.15
105 0.19
106 0.25
107 0.28
108 0.3
109 0.32
110 0.31
111 0.31
112 0.32
113 0.32
114 0.25
115 0.24
116 0.25
117 0.25
118 0.25
119 0.24
120 0.22
121 0.2
122 0.25
123 0.33
124 0.36
125 0.41
126 0.49
127 0.56
128 0.62
129 0.67
130 0.71
131 0.7
132 0.73
133 0.72
134 0.67
135 0.64
136 0.56
137 0.54
138 0.44
139 0.36
140 0.27
141 0.24
142 0.22
143 0.18
144 0.21
145 0.16
146 0.16
147 0.15
148 0.15
149 0.12
150 0.12
151 0.14
152 0.12
153 0.13
154 0.17
155 0.2
156 0.22
157 0.25
158 0.26
159 0.26
160 0.29
161 0.31
162 0.33
163 0.33
164 0.33
165 0.37
166 0.38
167 0.41
168 0.44
169 0.47
170 0.44
171 0.48
172 0.48