Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PVA4

Protein Details
Accession N1PVA4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
379-402EDYTEYKRLRREHHDKKDGRPPSIBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, pero 5.5, cyto_pero 5.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
Amino Acid Sequences MANMQRTSDTADVETSPQELSSYQSPSHGSHHALAVHQSRRLRVDDPWYDEQDTLDLPHDDMSRMPTMVTRVNDTTTNEPATPSWCDPEYLRHRARWIRDILDPQVARDGADALHSDEALTLDELLRRLLDHDMSLADIRFTRMHLAISEISGKATRWPKKLIDRCEAIKVVWEAKYGPLKTLGTPLYEPRGRLHDICRPEDLNKEKLLVKWLGSPAARLSPSVSRKVGDLGFVPGDWWISPMFAYRAGIIDSGNPAGGIVADGGGAYAIVLTDSDEVAGSDSNHFRYRARDGDPGRYRLTAATPESRQPIRILRSHTLHSFLKPRAGIRYDGLHTVTGWTVKQDAKTSQTVVTVSFMRLSSEVNMDAVLCRPWSDEVEDYTEYKRLRREHHDKKDGRPPSIIASDGANGHVWSIMLDAAVHPTMGGPTARSPDEERCRLQRGTLGSAMVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.15
4 0.13
5 0.13
6 0.11
7 0.14
8 0.17
9 0.2
10 0.2
11 0.23
12 0.26
13 0.27
14 0.31
15 0.31
16 0.3
17 0.28
18 0.31
19 0.3
20 0.29
21 0.33
22 0.36
23 0.36
24 0.38
25 0.38
26 0.38
27 0.4
28 0.43
29 0.39
30 0.36
31 0.42
32 0.44
33 0.49
34 0.52
35 0.52
36 0.5
37 0.48
38 0.43
39 0.35
40 0.28
41 0.21
42 0.18
43 0.15
44 0.13
45 0.17
46 0.17
47 0.16
48 0.16
49 0.19
50 0.18
51 0.17
52 0.17
53 0.15
54 0.18
55 0.23
56 0.24
57 0.25
58 0.24
59 0.26
60 0.29
61 0.31
62 0.32
63 0.3
64 0.31
65 0.26
66 0.25
67 0.24
68 0.24
69 0.26
70 0.23
71 0.23
72 0.21
73 0.22
74 0.22
75 0.31
76 0.36
77 0.41
78 0.44
79 0.43
80 0.5
81 0.55
82 0.6
83 0.57
84 0.54
85 0.48
86 0.49
87 0.51
88 0.47
89 0.49
90 0.43
91 0.36
92 0.35
93 0.31
94 0.26
95 0.22
96 0.19
97 0.11
98 0.12
99 0.12
100 0.09
101 0.1
102 0.09
103 0.09
104 0.08
105 0.09
106 0.08
107 0.08
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.08
114 0.07
115 0.09
116 0.1
117 0.1
118 0.09
119 0.1
120 0.09
121 0.1
122 0.11
123 0.1
124 0.09
125 0.08
126 0.1
127 0.1
128 0.1
129 0.12
130 0.12
131 0.12
132 0.12
133 0.15
134 0.13
135 0.14
136 0.16
137 0.13
138 0.13
139 0.13
140 0.12
141 0.16
142 0.24
143 0.3
144 0.31
145 0.36
146 0.41
147 0.51
148 0.59
149 0.6
150 0.58
151 0.56
152 0.55
153 0.55
154 0.5
155 0.39
156 0.34
157 0.29
158 0.25
159 0.21
160 0.19
161 0.15
162 0.18
163 0.25
164 0.21
165 0.2
166 0.21
167 0.21
168 0.21
169 0.25
170 0.22
171 0.18
172 0.19
173 0.19
174 0.22
175 0.23
176 0.23
177 0.2
178 0.23
179 0.23
180 0.24
181 0.27
182 0.26
183 0.29
184 0.31
185 0.32
186 0.29
187 0.28
188 0.33
189 0.33
190 0.3
191 0.27
192 0.27
193 0.26
194 0.25
195 0.28
196 0.22
197 0.19
198 0.19
199 0.19
200 0.2
201 0.18
202 0.18
203 0.15
204 0.17
205 0.16
206 0.13
207 0.14
208 0.17
209 0.2
210 0.24
211 0.23
212 0.2
213 0.21
214 0.23
215 0.21
216 0.16
217 0.13
218 0.11
219 0.11
220 0.1
221 0.1
222 0.07
223 0.07
224 0.06
225 0.06
226 0.04
227 0.04
228 0.05
229 0.06
230 0.06
231 0.07
232 0.07
233 0.07
234 0.07
235 0.08
236 0.08
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.06
243 0.05
244 0.05
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.02
254 0.02
255 0.02
256 0.02
257 0.02
258 0.02
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.04
265 0.05
266 0.05
267 0.05
268 0.08
269 0.09
270 0.12
271 0.14
272 0.15
273 0.15
274 0.19
275 0.24
276 0.26
277 0.29
278 0.34
279 0.35
280 0.45
281 0.5
282 0.5
283 0.46
284 0.42
285 0.38
286 0.31
287 0.31
288 0.25
289 0.23
290 0.24
291 0.24
292 0.27
293 0.31
294 0.31
295 0.3
296 0.28
297 0.31
298 0.3
299 0.33
300 0.36
301 0.37
302 0.4
303 0.42
304 0.41
305 0.4
306 0.37
307 0.36
308 0.36
309 0.32
310 0.34
311 0.32
312 0.32
313 0.34
314 0.34
315 0.33
316 0.28
317 0.32
318 0.29
319 0.29
320 0.29
321 0.22
322 0.2
323 0.19
324 0.18
325 0.14
326 0.12
327 0.11
328 0.13
329 0.15
330 0.17
331 0.2
332 0.22
333 0.25
334 0.28
335 0.29
336 0.27
337 0.27
338 0.25
339 0.22
340 0.22
341 0.18
342 0.16
343 0.16
344 0.15
345 0.14
346 0.14
347 0.14
348 0.14
349 0.15
350 0.15
351 0.12
352 0.12
353 0.11
354 0.11
355 0.11
356 0.1
357 0.08
358 0.08
359 0.1
360 0.12
361 0.13
362 0.16
363 0.18
364 0.19
365 0.24
366 0.25
367 0.26
368 0.26
369 0.29
370 0.26
371 0.27
372 0.31
373 0.32
374 0.39
375 0.48
376 0.57
377 0.63
378 0.74
379 0.81
380 0.8
381 0.82
382 0.85
383 0.81
384 0.74
385 0.66
386 0.56
387 0.52
388 0.49
389 0.42
390 0.32
391 0.27
392 0.26
393 0.23
394 0.22
395 0.16
396 0.13
397 0.12
398 0.12
399 0.1
400 0.08
401 0.08
402 0.07
403 0.06
404 0.06
405 0.06
406 0.09
407 0.1
408 0.09
409 0.08
410 0.08
411 0.09
412 0.11
413 0.11
414 0.1
415 0.13
416 0.18
417 0.2
418 0.22
419 0.26
420 0.34
421 0.44
422 0.48
423 0.51
424 0.53
425 0.58
426 0.56
427 0.54
428 0.49
429 0.45
430 0.45
431 0.42