Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2YI65

Protein Details
Accession M2YI65    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-38AFTRMRSRLRSRKERDHVLSHydrophilic
NLS Segment(s)
PositionSequence
28-31RSRK
Subcellular Location(s) nucl 11, cyto_nucl 10.333, cyto_mito 8.666, mito 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRISQIPGNLRAEHMDQVAFTRMRSRLRSRKERDHVLSKKKGVSIALPGPETALQACNDGETAPLMLQQGIEGSCIARKPVAGKAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.15
4 0.16
5 0.2
6 0.17
7 0.15
8 0.19
9 0.21
10 0.26
11 0.33
12 0.41
13 0.45
14 0.55
15 0.65
16 0.68
17 0.75
18 0.77
19 0.8
20 0.77
21 0.78
22 0.77
23 0.75
24 0.74
25 0.66
26 0.61
27 0.53
28 0.47
29 0.37
30 0.3
31 0.25
32 0.22
33 0.21
34 0.18
35 0.17
36 0.17
37 0.16
38 0.15
39 0.11
40 0.09
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.07
50 0.05
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.09
62 0.1
63 0.11
64 0.11
65 0.12
66 0.14