Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2YN63

Protein Details
Accession M2YN63    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-104DSEVPAKKPTPKKKATPKKRKIKEDHEVVVKABasic
NLS Segment(s)
PositionSequence
78-95AKKPTPKKKATPKKRKIK
Subcellular Location(s) nucl 16, cyto 8, mito 3
Family & Domain DBs
Amino Acid Sequences MAPVTNELFLLSCINHANNGRIDFKAVAQECGMNTPGAAAMRFRRFKEKHDTSLLNSASSLAAAQNGEGGDEDSEVPAKKPTPKKKATPKKRKIKEDHEVVVKAEPEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.17
4 0.2
5 0.23
6 0.26
7 0.26
8 0.24
9 0.27
10 0.23
11 0.22
12 0.26
13 0.23
14 0.21
15 0.19
16 0.2
17 0.18
18 0.19
19 0.19
20 0.11
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.08
27 0.12
28 0.2
29 0.23
30 0.25
31 0.33
32 0.35
33 0.39
34 0.49
35 0.5
36 0.47
37 0.51
38 0.51
39 0.43
40 0.49
41 0.45
42 0.34
43 0.28
44 0.23
45 0.16
46 0.14
47 0.12
48 0.04
49 0.05
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.06
59 0.06
60 0.05
61 0.07
62 0.07
63 0.08
64 0.1
65 0.12
66 0.2
67 0.3
68 0.41
69 0.5
70 0.57
71 0.67
72 0.76
73 0.85
74 0.88
75 0.9
76 0.9
77 0.91
78 0.93
79 0.94
80 0.93
81 0.91
82 0.9
83 0.88
84 0.85
85 0.81
86 0.73
87 0.63
88 0.57