Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DBG0

Protein Details
Accession B0DBG0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-38ELRLSDCRARNRKFRHRIRPRKRHPPVYGISBasic
NLS Segment(s)
PositionSequence
16-32ARNRKFRHRIRPRKRHP
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR000169  Pept_cys_AS  
IPR001300  Peptidase_C2_calpain_cat  
Gene Ontology GO:0004198  F:calcium-dependent cysteine-type endopeptidase activity  
GO:0003677  F:DNA binding  
GO:0006508  P:proteolysis  
KEGG lbc:LACBIDRAFT_297552  -  
Pfam View protein in Pfam  
PF00648  Peptidase_C2  
PROSITE View protein in PROSITE  
PS50203  CALPAIN_CAT  
PS00139  THIOL_PROTEASE_CYS  
Amino Acid Sequences MRRLRSVELRLSDCRARNRKFRHRIRPRKRHPPVYGISSPATSDNEGSHADALRVTQIFENPHFFLAKGAASLNDIAQGKLGDCWLLSAPAIASTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.57
4 0.62
5 0.69
6 0.75
7 0.79
8 0.84
9 0.85
10 0.87
11 0.92
12 0.94
13 0.95
14 0.94
15 0.94
16 0.93
17 0.92
18 0.86
19 0.82
20 0.75
21 0.72
22 0.63
23 0.55
24 0.46
25 0.36
26 0.31
27 0.24
28 0.21
29 0.13
30 0.12
31 0.09
32 0.1
33 0.1
34 0.1
35 0.09
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.07
44 0.09
45 0.11
46 0.12
47 0.16
48 0.15
49 0.16
50 0.16
51 0.15
52 0.14
53 0.13
54 0.12
55 0.09
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.12
62 0.12
63 0.11
64 0.12
65 0.12
66 0.12
67 0.12
68 0.12
69 0.08
70 0.07
71 0.09
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09