Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0D1K1

Protein Details
Accession B0D1K1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
62-82EKYLLGKKRYRQPTRTQREGMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_314087  -  
Amino Acid Sequences MTRKLYQLEEKKKIDQLRKEKEEDELQRLQEEQTGKKRTEKLEWLYAMPATGSISQNPNDLEKYLLGKKRYRQPTRTQREGMPHEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.68
4 0.69
5 0.71
6 0.71
7 0.65
8 0.62
9 0.62
10 0.56
11 0.52
12 0.45
13 0.39
14 0.36
15 0.35
16 0.3
17 0.25
18 0.23
19 0.22
20 0.27
21 0.3
22 0.3
23 0.35
24 0.4
25 0.39
26 0.42
27 0.44
28 0.39
29 0.42
30 0.42
31 0.37
32 0.33
33 0.29
34 0.24
35 0.17
36 0.12
37 0.07
38 0.08
39 0.08
40 0.09
41 0.12
42 0.12
43 0.14
44 0.15
45 0.16
46 0.14
47 0.14
48 0.14
49 0.13
50 0.17
51 0.22
52 0.27
53 0.3
54 0.35
55 0.42
56 0.51
57 0.61
58 0.65
59 0.66
60 0.72
61 0.79
62 0.83
63 0.84
64 0.79
65 0.73
66 0.74
67 0.73