Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PYX7

Protein Details
Accession N1PYX7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
246-270KDYGGEKPKEKPKPEQPAKKPDGYGBasic
NLS Segment(s)
PositionSequence
252-267KPKEKPKPEQPAKKPD
Subcellular Location(s) mito 9, cyto 7.5, cyto_nucl 6, extr 4, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKFILAAALVGTTLALPNYESSCPQPTCPICPPEKYCPPAETKYSTTTAYSTTTAYKPGPTEYQTATITEQKNCPNKYCPPAKTETQTIPTTITESKSCPNKYCPPAKTETQTIPTTIIESKSCPDKYCPPAKTETTTIPPVTVTGPAKSPAPYCPDKPERTVTFTATAKCPAPYCPDKPKETVTTTTSQSKDCPAPYCPPKQSFTVTEKIGAYPQPEKTITITEYQAPQATVTQVKTVTATQSCKDYGGEKPKEKPKPEQPAKKPDGYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.08
5 0.11
6 0.12
7 0.14
8 0.18
9 0.25
10 0.26
11 0.27
12 0.34
13 0.34
14 0.4
15 0.45
16 0.48
17 0.44
18 0.51
19 0.56
20 0.56
21 0.63
22 0.59
23 0.56
24 0.54
25 0.56
26 0.54
27 0.53
28 0.48
29 0.43
30 0.44
31 0.43
32 0.4
33 0.34
34 0.3
35 0.26
36 0.24
37 0.21
38 0.18
39 0.19
40 0.19
41 0.21
42 0.21
43 0.21
44 0.2
45 0.22
46 0.25
47 0.23
48 0.27
49 0.25
50 0.29
51 0.27
52 0.27
53 0.26
54 0.29
55 0.29
56 0.29
57 0.31
58 0.34
59 0.42
60 0.42
61 0.44
62 0.43
63 0.47
64 0.52
65 0.57
66 0.52
67 0.49
68 0.52
69 0.53
70 0.51
71 0.49
72 0.45
73 0.41
74 0.39
75 0.35
76 0.31
77 0.27
78 0.26
79 0.22
80 0.19
81 0.15
82 0.17
83 0.21
84 0.27
85 0.29
86 0.29
87 0.35
88 0.41
89 0.47
90 0.54
91 0.51
92 0.48
93 0.51
94 0.53
95 0.51
96 0.47
97 0.44
98 0.41
99 0.39
100 0.35
101 0.31
102 0.26
103 0.24
104 0.19
105 0.16
106 0.12
107 0.12
108 0.13
109 0.18
110 0.18
111 0.18
112 0.2
113 0.27
114 0.33
115 0.4
116 0.4
117 0.37
118 0.41
119 0.41
120 0.41
121 0.36
122 0.32
123 0.27
124 0.28
125 0.25
126 0.21
127 0.19
128 0.16
129 0.14
130 0.15
131 0.12
132 0.1
133 0.11
134 0.12
135 0.13
136 0.13
137 0.14
138 0.13
139 0.18
140 0.2
141 0.21
142 0.28
143 0.35
144 0.36
145 0.39
146 0.43
147 0.4
148 0.43
149 0.43
150 0.36
151 0.34
152 0.34
153 0.32
154 0.26
155 0.26
156 0.21
157 0.2
158 0.19
159 0.16
160 0.22
161 0.25
162 0.3
163 0.38
164 0.43
165 0.45
166 0.47
167 0.5
168 0.49
169 0.47
170 0.45
171 0.39
172 0.37
173 0.37
174 0.41
175 0.37
176 0.32
177 0.3
178 0.3
179 0.3
180 0.29
181 0.29
182 0.25
183 0.33
184 0.39
185 0.46
186 0.48
187 0.49
188 0.49
189 0.49
190 0.5
191 0.47
192 0.45
193 0.43
194 0.37
195 0.36
196 0.35
197 0.32
198 0.3
199 0.26
200 0.24
201 0.23
202 0.24
203 0.25
204 0.25
205 0.26
206 0.25
207 0.28
208 0.26
209 0.25
210 0.24
211 0.23
212 0.24
213 0.24
214 0.24
215 0.2
216 0.19
217 0.17
218 0.19
219 0.19
220 0.18
221 0.19
222 0.18
223 0.18
224 0.19
225 0.19
226 0.21
227 0.23
228 0.26
229 0.24
230 0.28
231 0.28
232 0.28
233 0.28
234 0.25
235 0.29
236 0.36
237 0.44
238 0.46
239 0.54
240 0.63
241 0.71
242 0.74
243 0.75
244 0.75
245 0.78
246 0.83
247 0.85
248 0.84
249 0.86
250 0.87
251 0.84