Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CSG9

Protein Details
Accession B0CSG9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77GYTIVKENKKKAQKARLRTAHydrophilic
NLS Segment(s)
PositionSequence
66-73KKKAQKAR
Subcellular Location(s) mito 8, plas 5, extr 5, cyto 3, E.R. 3, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG lbc:LACBIDRAFT_244765  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLAAYTVFTYYTAWALLLPFFPKTSQIHDWFPSREWAIRLPAVLLVLGLSAIGAFVGYTIVKENKKKAQKARLRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.13
11 0.15
12 0.2
13 0.25
14 0.28
15 0.31
16 0.33
17 0.36
18 0.34
19 0.33
20 0.3
21 0.25
22 0.23
23 0.2
24 0.19
25 0.19
26 0.17
27 0.16
28 0.14
29 0.13
30 0.11
31 0.09
32 0.07
33 0.04
34 0.04
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.13
49 0.18
50 0.23
51 0.3
52 0.39
53 0.48
54 0.57
55 0.64
56 0.7
57 0.75