Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PXK7

Protein Details
Accession N1PXK7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-45PKRRRLAKACESCRARKKRCIHFAEANNKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd12148  fungal_TF_MHR  
cd00067  GAL4  
Amino Acid Sequences MVVELTFVNQYGDSAPKRRRLAKACESCRARKKRCIHFAEANNKGDEDQDNDDEIPDDTSPLANGISHSRSGSSGVRRFISDMNPATTFLQRNNPNSTSGETRIGPNEDIGIWVDKREWDALLRQKNEASEEASSAAQLNNYKPHPTVLAPLIDIYFRKIHPIFPILNEEKIRNGHARVTTPEPLAHAICLVAAKDPEATPHLRLSESAVPLAPREF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.41
4 0.48
5 0.55
6 0.63
7 0.64
8 0.7
9 0.73
10 0.78
11 0.75
12 0.78
13 0.77
14 0.77
15 0.79
16 0.8
17 0.77
18 0.75
19 0.79
20 0.8
21 0.84
22 0.82
23 0.8
24 0.79
25 0.8
26 0.81
27 0.78
28 0.7
29 0.6
30 0.53
31 0.45
32 0.37
33 0.29
34 0.23
35 0.2
36 0.19
37 0.19
38 0.19
39 0.19
40 0.18
41 0.17
42 0.14
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.05
51 0.07
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.13
58 0.15
59 0.19
60 0.23
61 0.26
62 0.27
63 0.28
64 0.28
65 0.29
66 0.28
67 0.27
68 0.25
69 0.22
70 0.22
71 0.22
72 0.22
73 0.22
74 0.23
75 0.21
76 0.17
77 0.23
78 0.25
79 0.28
80 0.32
81 0.32
82 0.31
83 0.32
84 0.33
85 0.28
86 0.25
87 0.24
88 0.19
89 0.19
90 0.19
91 0.19
92 0.17
93 0.13
94 0.11
95 0.09
96 0.09
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.07
107 0.13
108 0.2
109 0.27
110 0.28
111 0.28
112 0.28
113 0.29
114 0.3
115 0.25
116 0.2
117 0.13
118 0.13
119 0.13
120 0.12
121 0.12
122 0.1
123 0.09
124 0.09
125 0.1
126 0.11
127 0.15
128 0.16
129 0.18
130 0.18
131 0.19
132 0.19
133 0.18
134 0.2
135 0.18
136 0.18
137 0.16
138 0.16
139 0.15
140 0.14
141 0.13
142 0.13
143 0.13
144 0.12
145 0.18
146 0.18
147 0.19
148 0.22
149 0.26
150 0.25
151 0.25
152 0.34
153 0.3
154 0.34
155 0.34
156 0.31
157 0.3
158 0.31
159 0.32
160 0.27
161 0.26
162 0.26
163 0.28
164 0.31
165 0.32
166 0.36
167 0.37
168 0.35
169 0.34
170 0.3
171 0.3
172 0.27
173 0.22
174 0.16
175 0.13
176 0.11
177 0.12
178 0.1
179 0.09
180 0.09
181 0.09
182 0.11
183 0.12
184 0.14
185 0.17
186 0.19
187 0.19
188 0.23
189 0.24
190 0.22
191 0.23
192 0.26
193 0.3
194 0.29
195 0.28
196 0.26
197 0.25