Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PGF2

Protein Details
Accession N1PGF2   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-97NPSRVPRRGSRVQRRDRTPQSLHydrophilic
NLS Segment(s)
PositionSequence
82-83RR
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MSFRHRVDCSDDTRVGKGLSICTSYSRNPSFSVQMTIARSAVRATASNIHCRLPLPCILVLELGQSGPPRHQSRHNPSRVPRRGSRVQRRDRTPQSLPPSSAAPPQPISRASGAECTCLAGSIGLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.35
3 0.32
4 0.27
5 0.24
6 0.21
7 0.21
8 0.2
9 0.21
10 0.24
11 0.24
12 0.31
13 0.3
14 0.29
15 0.29
16 0.31
17 0.32
18 0.3
19 0.31
20 0.25
21 0.26
22 0.26
23 0.24
24 0.22
25 0.18
26 0.17
27 0.13
28 0.13
29 0.1
30 0.09
31 0.1
32 0.18
33 0.19
34 0.25
35 0.26
36 0.26
37 0.25
38 0.25
39 0.24
40 0.18
41 0.19
42 0.15
43 0.15
44 0.14
45 0.14
46 0.14
47 0.13
48 0.11
49 0.08
50 0.06
51 0.05
52 0.06
53 0.06
54 0.07
55 0.13
56 0.16
57 0.18
58 0.26
59 0.36
60 0.45
61 0.55
62 0.61
63 0.61
64 0.66
65 0.75
66 0.75
67 0.72
68 0.67
69 0.64
70 0.67
71 0.72
72 0.75
73 0.75
74 0.77
75 0.8
76 0.81
77 0.83
78 0.81
79 0.78
80 0.72
81 0.7
82 0.68
83 0.64
84 0.59
85 0.51
86 0.46
87 0.4
88 0.41
89 0.34
90 0.3
91 0.27
92 0.28
93 0.29
94 0.28
95 0.29
96 0.26
97 0.26
98 0.23
99 0.28
100 0.27
101 0.26
102 0.25
103 0.24
104 0.22
105 0.2
106 0.18