Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PD53

Protein Details
Accession N1PD53   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
112-133DESPSKKAKTTKVKPEPKADAEHydrophilic
NLS Segment(s)
PositionSequence
84-95VIKRTPTSKRGR
Subcellular Location(s) nucl 13, cyto_nucl 11.833, cyto 9.5, mito_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MPLSEKQMSYLALAWQCFETEPKIDYDKFKQVAGLASSHSARELMRVTKKKLKEEYGALSGTIASSNVTAVIRTGGGKASPSKVIKRTPTSKRGRAKQVASEVVTASEDGDDESPSKKAKTTKVKPEPKADAEEDDDDWLGMFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.17
5 0.17
6 0.15
7 0.14
8 0.16
9 0.18
10 0.22
11 0.24
12 0.28
13 0.32
14 0.38
15 0.37
16 0.36
17 0.34
18 0.3
19 0.32
20 0.29
21 0.24
22 0.16
23 0.17
24 0.17
25 0.16
26 0.15
27 0.12
28 0.1
29 0.12
30 0.14
31 0.18
32 0.27
33 0.32
34 0.38
35 0.45
36 0.5
37 0.55
38 0.58
39 0.57
40 0.52
41 0.51
42 0.49
43 0.45
44 0.4
45 0.32
46 0.26
47 0.21
48 0.16
49 0.12
50 0.07
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.08
66 0.09
67 0.14
68 0.16
69 0.2
70 0.24
71 0.3
72 0.35
73 0.41
74 0.48
75 0.51
76 0.59
77 0.64
78 0.68
79 0.72
80 0.74
81 0.76
82 0.75
83 0.71
84 0.67
85 0.65
86 0.61
87 0.53
88 0.46
89 0.36
90 0.29
91 0.26
92 0.19
93 0.12
94 0.08
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.09
101 0.11
102 0.12
103 0.13
104 0.17
105 0.22
106 0.31
107 0.42
108 0.5
109 0.6
110 0.69
111 0.78
112 0.81
113 0.84
114 0.83
115 0.76
116 0.73
117 0.64
118 0.58
119 0.52
120 0.48
121 0.4
122 0.33
123 0.29
124 0.22