Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PPM2

Protein Details
Accession N1PPM2   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-51NSLSKRSRVRHGKRPQLHRTBasic
NLS Segment(s)
PositionSequence
38-44SRVRHGK
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
Amino Acid Sequences DHVHRSSKIRIWKTRQHGAPHNRAGSIPGQNNSLSKRSRVRHGKRPQLHRTGCFAGNLLLCHTENDGVRWPSARPSIPQQQERGLKEWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.75
4 0.75
5 0.75
6 0.76
7 0.74
8 0.67
9 0.58
10 0.52
11 0.46
12 0.4
13 0.37
14 0.31
15 0.25
16 0.25
17 0.25
18 0.27
19 0.27
20 0.28
21 0.23
22 0.23
23 0.3
24 0.31
25 0.4
26 0.49
27 0.54
28 0.59
29 0.67
30 0.74
31 0.73
32 0.8
33 0.78
34 0.78
35 0.74
36 0.66
37 0.62
38 0.55
39 0.48
40 0.39
41 0.31
42 0.24
43 0.21
44 0.19
45 0.14
46 0.13
47 0.12
48 0.12
49 0.13
50 0.13
51 0.12
52 0.14
53 0.19
54 0.18
55 0.19
56 0.19
57 0.19
58 0.22
59 0.27
60 0.27
61 0.25
62 0.32
63 0.42
64 0.49
65 0.54
66 0.53
67 0.56
68 0.62
69 0.62