Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PEY4

Protein Details
Accession A0A1D8PEY4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-34ESSADVKKKSKSQNKKGALTQKKKSHydrophilic
NLS Segment(s)
PositionSequence
16-33KKKSKSQNKKGALTQKKK
Subcellular Location(s) plas 20, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008389  ATPase_V0-cplx_e1/e2_su  
Gene Ontology GO:0000220  C:vacuolar proton-transporting V-type ATPase, V0 domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
GO:0055085  P:transmembrane transport  
GO:0007035  P:vacuolar acidification  
KEGG cal:CAALFM_C110750CA  -  
Pfam View protein in Pfam  
PF05493  ATP_synt_H  
Amino Acid Sequences MWVFVYKFEESSADVKKKSKSQNKKGALTQKKKSNLRVINNISCRLKPNSKDTRLSKMSGYSVVAVFIVVVALSCLAWVFAPKENTTVFRSSVILALSMCYLMWAITYLAQLHPLEAPRRSDLRPEPKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.47
5 0.55
6 0.61
7 0.64
8 0.7
9 0.78
10 0.82
11 0.83
12 0.83
13 0.83
14 0.83
15 0.81
16 0.78
17 0.76
18 0.77
19 0.76
20 0.75
21 0.75
22 0.72
23 0.7
24 0.72
25 0.7
26 0.69
27 0.66
28 0.65
29 0.57
30 0.49
31 0.46
32 0.42
33 0.41
34 0.37
35 0.43
36 0.48
37 0.51
38 0.58
39 0.58
40 0.6
41 0.57
42 0.54
43 0.45
44 0.38
45 0.33
46 0.26
47 0.23
48 0.15
49 0.12
50 0.11
51 0.1
52 0.07
53 0.06
54 0.04
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.04
66 0.05
67 0.09
68 0.12
69 0.12
70 0.14
71 0.15
72 0.19
73 0.21
74 0.21
75 0.19
76 0.18
77 0.18
78 0.17
79 0.18
80 0.15
81 0.12
82 0.1
83 0.1
84 0.09
85 0.08
86 0.07
87 0.05
88 0.05
89 0.04
90 0.04
91 0.05
92 0.05
93 0.07
94 0.08
95 0.09
96 0.09
97 0.13
98 0.13
99 0.13
100 0.15
101 0.18
102 0.22
103 0.24
104 0.28
105 0.3
106 0.34
107 0.35
108 0.41
109 0.47