Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PJ51

Protein Details
Accession N1PJ51   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-39VNVPKTRRTYCKGRDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLRTSEEGLPVNVPKTRRTYCKGRDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.36
4 0.4
5 0.45
6 0.53
7 0.6
8 0.69
9 0.76
10 0.77
11 0.82
12 0.82
13 0.87
14 0.87
15 0.88
16 0.87
17 0.86
18 0.85
19 0.84
20 0.87
21 0.79
22 0.78
23 0.71
24 0.66
25 0.59
26 0.53
27 0.43
28 0.34
29 0.32
30 0.32
31 0.31
32 0.27
33 0.32
34 0.36
35 0.4
36 0.45
37 0.49
38 0.46
39 0.52
40 0.59
41 0.57
42 0.58
43 0.57
44 0.56
45 0.54
46 0.57
47 0.48
48 0.43
49 0.4
50 0.33
51 0.35
52 0.37
53 0.36
54 0.31
55 0.38
56 0.43
57 0.51
58 0.6
59 0.63
60 0.62
61 0.66
62 0.73
63 0.73
64 0.72
65 0.68
66 0.65
67 0.64
68 0.66
69 0.63
70 0.58
71 0.56
72 0.51
73 0.46
74 0.44
75 0.42
76 0.42
77 0.45
78 0.48
79 0.52
80 0.61
81 0.66
82 0.69
83 0.67
84 0.61
85 0.56
86 0.51
87 0.49
88 0.5
89 0.5
90 0.52
91 0.54
92 0.52
93 0.49
94 0.49
95 0.42