Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PBY8

Protein Details
Accession N1PBY8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
127-151TKEHETRRPERRKEDARAYNRRGRPBasic
NLS Segment(s)
PositionSequence
133-157RRPERRKEDARAYNRRGRPGGSIPA
Subcellular Location(s) mito 14, cyto 8.5, cyto_nucl 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046539  DUF6604  
Pfam View protein in Pfam  
PF20253  DUF6604  
Amino Acid Sequences MSDYTLVNTYKRYKAGTQKLVRWLTESASRCHTDSPNSSRKPRVARKIRTAELVACTEHIVAAKDPRVEVPPDILDVTKVVITGCTCCVEFYASLSQGADLDPSLLAANASHKHFLGVRVQIFDILTKEHETRRPERRKEDARAYNRRGRPGGSIPAPRTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.62
4 0.64
5 0.66
6 0.72
7 0.72
8 0.65
9 0.58
10 0.48
11 0.41
12 0.41
13 0.37
14 0.3
15 0.32
16 0.34
17 0.31
18 0.34
19 0.33
20 0.31
21 0.37
22 0.42
23 0.46
24 0.5
25 0.54
26 0.56
27 0.6
28 0.64
29 0.65
30 0.68
31 0.69
32 0.71
33 0.77
34 0.8
35 0.76
36 0.7
37 0.62
38 0.53
39 0.46
40 0.39
41 0.28
42 0.2
43 0.18
44 0.14
45 0.12
46 0.1
47 0.08
48 0.08
49 0.1
50 0.12
51 0.12
52 0.13
53 0.13
54 0.15
55 0.15
56 0.14
57 0.14
58 0.12
59 0.12
60 0.12
61 0.11
62 0.09
63 0.08
64 0.08
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.09
79 0.11
80 0.11
81 0.11
82 0.11
83 0.1
84 0.09
85 0.09
86 0.07
87 0.04
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.08
96 0.1
97 0.12
98 0.13
99 0.13
100 0.14
101 0.15
102 0.17
103 0.2
104 0.22
105 0.22
106 0.23
107 0.23
108 0.23
109 0.22
110 0.21
111 0.16
112 0.12
113 0.13
114 0.14
115 0.16
116 0.19
117 0.25
118 0.3
119 0.38
120 0.47
121 0.56
122 0.62
123 0.68
124 0.74
125 0.77
126 0.8
127 0.83
128 0.82
129 0.82
130 0.84
131 0.83
132 0.83
133 0.79
134 0.78
135 0.69
136 0.61
137 0.58
138 0.54
139 0.56
140 0.54
141 0.57