Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PCV8

Protein Details
Accession N1PCV8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-111NDTSKLSRSKRKKLAKTVERKPQTHydrophilic
NLS Segment(s)
PositionSequence
95-103RSKRKKLAK
Subcellular Location(s) nucl 10, cyto_nucl 10, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MSTPEPFCSMCGQTGHTYTKKDDEKEMKAQGAAMRRNVEQKMKAALINAADEATALGAHYSALNAFRTLEVSGPAKATDLMSKAPETNDTSKLSRSKRKKLAKTVERKPQTILELFKAEGSDQLPGWAEVFGDAVPQNAEAKRRFTTGVNNVYKGRAGLVKDGLLHQKLIERSINPKEHGMKFADEMDEEMEEADENSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.35
4 0.36
5 0.36
6 0.43
7 0.46
8 0.45
9 0.49
10 0.51
11 0.54
12 0.58
13 0.6
14 0.52
15 0.46
16 0.46
17 0.4
18 0.4
19 0.37
20 0.34
21 0.32
22 0.32
23 0.38
24 0.39
25 0.42
26 0.36
27 0.36
28 0.37
29 0.35
30 0.34
31 0.29
32 0.28
33 0.23
34 0.2
35 0.17
36 0.12
37 0.1
38 0.09
39 0.08
40 0.06
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.11
60 0.11
61 0.1
62 0.1
63 0.1
64 0.1
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.12
71 0.12
72 0.14
73 0.16
74 0.18
75 0.2
76 0.21
77 0.22
78 0.25
79 0.31
80 0.34
81 0.39
82 0.44
83 0.51
84 0.58
85 0.67
86 0.71
87 0.75
88 0.8
89 0.8
90 0.82
91 0.81
92 0.81
93 0.75
94 0.68
95 0.6
96 0.52
97 0.45
98 0.39
99 0.32
100 0.25
101 0.22
102 0.21
103 0.2
104 0.17
105 0.14
106 0.12
107 0.11
108 0.09
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.07
115 0.06
116 0.05
117 0.06
118 0.05
119 0.06
120 0.06
121 0.05
122 0.06
123 0.06
124 0.09
125 0.1
126 0.15
127 0.15
128 0.19
129 0.2
130 0.22
131 0.24
132 0.23
133 0.31
134 0.35
135 0.43
136 0.42
137 0.44
138 0.43
139 0.42
140 0.41
141 0.32
142 0.25
143 0.18
144 0.17
145 0.18
146 0.19
147 0.19
148 0.2
149 0.23
150 0.26
151 0.23
152 0.22
153 0.19
154 0.22
155 0.22
156 0.25
157 0.26
158 0.22
159 0.29
160 0.37
161 0.43
162 0.39
163 0.45
164 0.49
165 0.48
166 0.5
167 0.46
168 0.39
169 0.36
170 0.36
171 0.32
172 0.24
173 0.22
174 0.2
175 0.17
176 0.14
177 0.13
178 0.1
179 0.08
180 0.09