Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2Y4E8

Protein Details
Accession M2Y4E8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-91AKTHPKKKTPAKKAAGEKRGBasic
NLS Segment(s)
PositionSequence
70-101AAAKTHPKKKTPAKKAAGEKRGTDKRKAVKKA
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
Amino Acid Sequences MVNWDDSLDKRLLLTIIAVAAPSAIDYKKVAALMGDEYTSGSVQQRYTKKLKKEAEEKFGALGAAGEGEAAAKTHPKKKTPAKKAAGEKRGTDKRKAVKKASEDEEGEKDDEESPSKKVKMERKEESEDEDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.09
4 0.08
5 0.08
6 0.06
7 0.06
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.11
16 0.11
17 0.11
18 0.09
19 0.1
20 0.11
21 0.11
22 0.1
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.1
31 0.18
32 0.21
33 0.27
34 0.36
35 0.42
36 0.46
37 0.54
38 0.59
39 0.6
40 0.66
41 0.66
42 0.64
43 0.6
44 0.54
45 0.44
46 0.38
47 0.3
48 0.2
49 0.14
50 0.06
51 0.04
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.06
60 0.09
61 0.16
62 0.2
63 0.24
64 0.32
65 0.43
66 0.54
67 0.6
68 0.68
69 0.69
70 0.73
71 0.8
72 0.81
73 0.79
74 0.71
75 0.64
76 0.63
77 0.66
78 0.62
79 0.57
80 0.55
81 0.56
82 0.63
83 0.67
84 0.65
85 0.63
86 0.66
87 0.69
88 0.66
89 0.63
90 0.55
91 0.52
92 0.48
93 0.42
94 0.36
95 0.28
96 0.25
97 0.2
98 0.19
99 0.19
100 0.17
101 0.18
102 0.25
103 0.26
104 0.29
105 0.35
106 0.43
107 0.49
108 0.58
109 0.64
110 0.65
111 0.71
112 0.7
113 0.69