Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0E4B1

Protein Details
Accession B0E4B1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
213-235MQLYRQRRSEKYKVPKEWSEKVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 13, cyto 11
Family & Domain DBs
KEGG lbc:LACBIDRAFT_336070  -  
Amino Acid Sequences PVVAIVTKFDTFLQDMQQKLEEKAEEEDEEVDDDELEKIAGVEADKRFEQHYKKPLLSMQHPPRAVVTLSEETQRQARSGYDLRTFFASAQSADSKVKLITSTAYSEKMFRGGPFIKTWDTFWTDSTSGPQAPIKLIRLLEKHLDDSRRLIGHRQSSDFSEVNARPDLLAFYTVLIMEKVYVFNINDEKTLEAMIKWYDQGSNTATYIRKEVMQLYRQRRSEKYKVPKEWSEKVAQPLIDLVCKRPVEVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.33
5 0.32
6 0.31
7 0.34
8 0.27
9 0.25
10 0.27
11 0.28
12 0.23
13 0.22
14 0.22
15 0.18
16 0.18
17 0.16
18 0.13
19 0.1
20 0.1
21 0.09
22 0.08
23 0.07
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.11
30 0.13
31 0.16
32 0.16
33 0.18
34 0.2
35 0.26
36 0.32
37 0.35
38 0.43
39 0.47
40 0.47
41 0.49
42 0.5
43 0.5
44 0.5
45 0.52
46 0.52
47 0.53
48 0.52
49 0.5
50 0.47
51 0.42
52 0.37
53 0.27
54 0.24
55 0.19
56 0.2
57 0.21
58 0.2
59 0.19
60 0.23
61 0.22
62 0.16
63 0.14
64 0.14
65 0.18
66 0.22
67 0.25
68 0.27
69 0.27
70 0.28
71 0.29
72 0.28
73 0.22
74 0.21
75 0.17
76 0.12
77 0.13
78 0.14
79 0.13
80 0.13
81 0.14
82 0.12
83 0.11
84 0.11
85 0.09
86 0.09
87 0.08
88 0.1
89 0.12
90 0.13
91 0.15
92 0.15
93 0.16
94 0.15
95 0.16
96 0.15
97 0.12
98 0.16
99 0.16
100 0.18
101 0.18
102 0.2
103 0.2
104 0.19
105 0.2
106 0.17
107 0.19
108 0.18
109 0.17
110 0.18
111 0.17
112 0.17
113 0.18
114 0.16
115 0.13
116 0.13
117 0.13
118 0.1
119 0.11
120 0.12
121 0.12
122 0.13
123 0.14
124 0.16
125 0.17
126 0.19
127 0.21
128 0.2
129 0.22
130 0.23
131 0.25
132 0.22
133 0.23
134 0.24
135 0.22
136 0.21
137 0.22
138 0.24
139 0.29
140 0.31
141 0.32
142 0.3
143 0.3
144 0.34
145 0.3
146 0.25
147 0.26
148 0.23
149 0.24
150 0.23
151 0.21
152 0.16
153 0.16
154 0.16
155 0.09
156 0.1
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.06
163 0.06
164 0.05
165 0.06
166 0.06
167 0.06
168 0.08
169 0.08
170 0.11
171 0.14
172 0.14
173 0.15
174 0.15
175 0.16
176 0.14
177 0.14
178 0.12
179 0.09
180 0.1
181 0.1
182 0.1
183 0.1
184 0.11
185 0.11
186 0.12
187 0.14
188 0.15
189 0.16
190 0.16
191 0.19
192 0.2
193 0.2
194 0.22
195 0.2
196 0.2
197 0.19
198 0.25
199 0.28
200 0.35
201 0.43
202 0.49
203 0.57
204 0.61
205 0.65
206 0.66
207 0.67
208 0.7
209 0.71
210 0.73
211 0.75
212 0.79
213 0.82
214 0.84
215 0.82
216 0.8
217 0.75
218 0.71
219 0.65
220 0.62
221 0.59
222 0.5
223 0.42
224 0.38
225 0.35
226 0.34
227 0.3
228 0.27
229 0.3
230 0.3
231 0.31