Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q4Z5

Protein Details
Accession N1Q4Z5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-102KGRAATPSQSKPKSRRRSIFGGRHDDHydrophilic
NLS Segment(s)
PositionSequence
86-93SKPKSRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MGLASFFAAWRGDKAKVATPQSPPLRRSNDHHLASSTSRHQRLGSYEAPRHPVTALPSPPPNAASATVAASNEERSKGRAATPSQSKPKSRRRSIFGGRHDDDEYVPAMPGRAYSRHNKARDGIEMMPPGSAASNDSQTSATTSKPRRLSLGYALGSRSKDDSKRKSWFSSNRQTITAADMPPLPPMPVIIPDTRGSARAALPLDKRRSRAASIKSTTSTVRGPKRRSFWASSNPDDSDEEIPPVPSLTPDSMTSDPFDNVDYTRSVDLTQTTTRTYDTKPGRPLSVSTVRTVRSYKPKSAAKGFLKSTSGATETARLSYRKSFNVEDDAAMVCLTEEQRIEWAKLMNEGDTFQDHSLRTMKSHTSDCSGKDKFSNDQALAALEFGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.38
4 0.43
5 0.45
6 0.47
7 0.55
8 0.6
9 0.64
10 0.61
11 0.62
12 0.65
13 0.63
14 0.65
15 0.66
16 0.66
17 0.62
18 0.61
19 0.53
20 0.49
21 0.48
22 0.47
23 0.45
24 0.44
25 0.44
26 0.43
27 0.42
28 0.41
29 0.43
30 0.44
31 0.43
32 0.42
33 0.46
34 0.49
35 0.53
36 0.49
37 0.46
38 0.39
39 0.35
40 0.32
41 0.34
42 0.33
43 0.32
44 0.36
45 0.37
46 0.37
47 0.35
48 0.31
49 0.25
50 0.23
51 0.2
52 0.17
53 0.16
54 0.16
55 0.15
56 0.15
57 0.14
58 0.15
59 0.16
60 0.17
61 0.16
62 0.17
63 0.21
64 0.21
65 0.25
66 0.29
67 0.31
68 0.37
69 0.45
70 0.51
71 0.58
72 0.63
73 0.67
74 0.7
75 0.77
76 0.79
77 0.8
78 0.8
79 0.77
80 0.8
81 0.83
82 0.83
83 0.81
84 0.79
85 0.71
86 0.66
87 0.6
88 0.5
89 0.4
90 0.32
91 0.24
92 0.14
93 0.13
94 0.1
95 0.09
96 0.08
97 0.09
98 0.11
99 0.13
100 0.17
101 0.24
102 0.34
103 0.42
104 0.45
105 0.46
106 0.47
107 0.48
108 0.47
109 0.45
110 0.37
111 0.33
112 0.32
113 0.29
114 0.25
115 0.21
116 0.17
117 0.13
118 0.1
119 0.07
120 0.07
121 0.09
122 0.1
123 0.11
124 0.11
125 0.11
126 0.14
127 0.13
128 0.14
129 0.2
130 0.23
131 0.29
132 0.33
133 0.34
134 0.34
135 0.36
136 0.37
137 0.35
138 0.39
139 0.33
140 0.31
141 0.31
142 0.3
143 0.28
144 0.25
145 0.22
146 0.18
147 0.24
148 0.32
149 0.38
150 0.43
151 0.5
152 0.53
153 0.55
154 0.6
155 0.62
156 0.62
157 0.66
158 0.65
159 0.6
160 0.57
161 0.54
162 0.45
163 0.4
164 0.35
165 0.24
166 0.18
167 0.16
168 0.16
169 0.15
170 0.15
171 0.1
172 0.07
173 0.07
174 0.06
175 0.08
176 0.1
177 0.1
178 0.12
179 0.12
180 0.14
181 0.14
182 0.15
183 0.13
184 0.12
185 0.12
186 0.13
187 0.13
188 0.15
189 0.19
190 0.25
191 0.32
192 0.33
193 0.35
194 0.35
195 0.37
196 0.38
197 0.41
198 0.41
199 0.43
200 0.43
201 0.43
202 0.41
203 0.4
204 0.36
205 0.31
206 0.28
207 0.26
208 0.32
209 0.37
210 0.42
211 0.47
212 0.51
213 0.56
214 0.58
215 0.56
216 0.54
217 0.57
218 0.57
219 0.54
220 0.53
221 0.46
222 0.42
223 0.37
224 0.33
225 0.26
226 0.19
227 0.18
228 0.14
229 0.14
230 0.12
231 0.12
232 0.1
233 0.07
234 0.09
235 0.08
236 0.1
237 0.1
238 0.15
239 0.15
240 0.16
241 0.17
242 0.17
243 0.16
244 0.15
245 0.15
246 0.11
247 0.11
248 0.12
249 0.11
250 0.11
251 0.11
252 0.11
253 0.11
254 0.11
255 0.12
256 0.14
257 0.16
258 0.16
259 0.16
260 0.17
261 0.18
262 0.2
263 0.2
264 0.25
265 0.3
266 0.35
267 0.41
268 0.43
269 0.44
270 0.43
271 0.43
272 0.42
273 0.44
274 0.38
275 0.34
276 0.36
277 0.35
278 0.36
279 0.37
280 0.36
281 0.38
282 0.43
283 0.46
284 0.51
285 0.56
286 0.59
287 0.64
288 0.66
289 0.62
290 0.64
291 0.6
292 0.55
293 0.51
294 0.46
295 0.4
296 0.33
297 0.28
298 0.21
299 0.19
300 0.2
301 0.19
302 0.2
303 0.23
304 0.21
305 0.22
306 0.3
307 0.34
308 0.34
309 0.38
310 0.38
311 0.39
312 0.45
313 0.43
314 0.35
315 0.31
316 0.28
317 0.23
318 0.19
319 0.15
320 0.08
321 0.09
322 0.09
323 0.09
324 0.09
325 0.09
326 0.15
327 0.18
328 0.19
329 0.2
330 0.22
331 0.21
332 0.27
333 0.27
334 0.23
335 0.21
336 0.21
337 0.2
338 0.19
339 0.21
340 0.17
341 0.2
342 0.19
343 0.21
344 0.26
345 0.25
346 0.25
347 0.27
348 0.31
349 0.32
350 0.37
351 0.36
352 0.38
353 0.41
354 0.43
355 0.48
356 0.45
357 0.43
358 0.43
359 0.44
360 0.43
361 0.47
362 0.5
363 0.41
364 0.41
365 0.39
366 0.36
367 0.32
368 0.26