Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2XGW9

Protein Details
Accession M2XGW9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-64LTRTPRRKFRICCKLQNRDTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 13.5, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MLAPLHTSAPSIDIFPSATVDRSIRSHGGYRLRNRMVGKEGPDVLTRTPRRKFRICCKLQNRDTPLPSIHILQNWGVERPRNAIGVALIAYKGDSFADGSNSPGKLVQSRIRAGWRIIDICSGDVNDVVADIVVEAVDLIDSSFDSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.12
5 0.13
6 0.14
7 0.14
8 0.16
9 0.17
10 0.21
11 0.2
12 0.21
13 0.25
14 0.29
15 0.37
16 0.43
17 0.48
18 0.53
19 0.53
20 0.56
21 0.53
22 0.51
23 0.48
24 0.44
25 0.41
26 0.36
27 0.35
28 0.32
29 0.32
30 0.29
31 0.25
32 0.3
33 0.31
34 0.34
35 0.4
36 0.46
37 0.51
38 0.59
39 0.65
40 0.66
41 0.72
42 0.72
43 0.76
44 0.77
45 0.81
46 0.78
47 0.79
48 0.76
49 0.7
50 0.65
51 0.56
52 0.48
53 0.4
54 0.35
55 0.28
56 0.21
57 0.16
58 0.15
59 0.13
60 0.15
61 0.13
62 0.14
63 0.13
64 0.13
65 0.13
66 0.15
67 0.16
68 0.13
69 0.13
70 0.12
71 0.11
72 0.1
73 0.1
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.08
85 0.08
86 0.11
87 0.14
88 0.14
89 0.14
90 0.14
91 0.15
92 0.14
93 0.19
94 0.23
95 0.26
96 0.28
97 0.31
98 0.34
99 0.36
100 0.34
101 0.34
102 0.32
103 0.28
104 0.26
105 0.26
106 0.22
107 0.21
108 0.21
109 0.16
110 0.13
111 0.11
112 0.11
113 0.08
114 0.07
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03