Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PUN3

Protein Details
Accession N1PUN3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-58DTRNHRPRYEQDRSRSPRGRDRRDDRRRDRSPPRNNPNSRAGBasic
NLS Segment(s)
PositionSequence
11-95RRGPRDDTRNHRPRYEQDRSRSPRGRDRRDDRRRDRSPPRNNPNSRAGPPPRDNRDRNDYQRNGPPRGPGGRPDIKREPLDSKVA
97-97K
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSDRFGRRDDRRGPRDDTRNHRPRYEQDRSRSPRGRDRRDDRRRDRSPPRNNPNSRAGPPPRDNRDRNDYQRNGPPRGPGGRPDIKREPLDSKVAIKKEPKPDIDMNMLDGEDEEAAMQRIMGFKDFRTTKNTKVPGNDRNYAVHKVKKVEYRQYMNRVGGFNRPLSPSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.76
4 0.75
5 0.75
6 0.78
7 0.76
8 0.74
9 0.7
10 0.7
11 0.71
12 0.72
13 0.69
14 0.68
15 0.75
16 0.77
17 0.81
18 0.79
19 0.76
20 0.75
21 0.77
22 0.79
23 0.79
24 0.81
25 0.82
26 0.85
27 0.9
28 0.89
29 0.89
30 0.86
31 0.85
32 0.86
33 0.86
34 0.86
35 0.86
36 0.86
37 0.86
38 0.84
39 0.8
40 0.78
41 0.74
42 0.65
43 0.63
44 0.58
45 0.56
46 0.58
47 0.62
48 0.61
49 0.63
50 0.63
51 0.6
52 0.63
53 0.62
54 0.63
55 0.64
56 0.59
57 0.55
58 0.6
59 0.6
60 0.55
61 0.48
62 0.43
63 0.37
64 0.38
65 0.34
66 0.3
67 0.32
68 0.35
69 0.36
70 0.4
71 0.41
72 0.41
73 0.41
74 0.41
75 0.37
76 0.32
77 0.34
78 0.28
79 0.28
80 0.29
81 0.29
82 0.3
83 0.31
84 0.35
85 0.41
86 0.45
87 0.42
88 0.42
89 0.43
90 0.43
91 0.43
92 0.36
93 0.29
94 0.24
95 0.22
96 0.16
97 0.14
98 0.11
99 0.06
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.06
108 0.07
109 0.09
110 0.1
111 0.1
112 0.18
113 0.21
114 0.23
115 0.29
116 0.32
117 0.37
118 0.46
119 0.51
120 0.47
121 0.53
122 0.59
123 0.6
124 0.63
125 0.61
126 0.54
127 0.53
128 0.54
129 0.53
130 0.51
131 0.48
132 0.46
133 0.46
134 0.51
135 0.54
136 0.58
137 0.61
138 0.64
139 0.66
140 0.7
141 0.73
142 0.73
143 0.68
144 0.64
145 0.57
146 0.5
147 0.49
148 0.44
149 0.39
150 0.36
151 0.36