Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PDG8

Protein Details
Accession N1PDG8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-113RNPPIRRLPDQLRPRRKWRPSPEPLPAASHydrophilic
NLS Segment(s)
PositionSequence
59-104QRPGSHRRKQDLPLQRARPSSELQRPRNPPIRRLPDQLRPRRKWRP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences TTNKSHQSHPAIPHDLPRGASRPSNHSDQCQPTPSPRGFARIDPQHQHPRRHLTRPYHQRPGSHRRKQDLPLQRARPSSELQRPRNPPIRRLPDQLRPRRKWRPSPEPLPAASYPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.41
4 0.38
5 0.33
6 0.31
7 0.34
8 0.31
9 0.33
10 0.35
11 0.41
12 0.39
13 0.4
14 0.45
15 0.47
16 0.48
17 0.46
18 0.43
19 0.4
20 0.45
21 0.41
22 0.38
23 0.32
24 0.34
25 0.31
26 0.32
27 0.36
28 0.36
29 0.41
30 0.4
31 0.46
32 0.52
33 0.56
34 0.58
35 0.55
36 0.58
37 0.58
38 0.61
39 0.62
40 0.59
41 0.63
42 0.69
43 0.71
44 0.71
45 0.67
46 0.65
47 0.65
48 0.68
49 0.69
50 0.66
51 0.64
52 0.59
53 0.63
54 0.62
55 0.63
56 0.63
57 0.59
58 0.61
59 0.61
60 0.6
61 0.57
62 0.56
63 0.49
64 0.42
65 0.42
66 0.43
67 0.47
68 0.49
69 0.56
70 0.59
71 0.64
72 0.71
73 0.66
74 0.64
75 0.65
76 0.68
77 0.64
78 0.67
79 0.66
80 0.66
81 0.74
82 0.77
83 0.77
84 0.76
85 0.8
86 0.83
87 0.86
88 0.87
89 0.86
90 0.87
91 0.86
92 0.88
93 0.87
94 0.82
95 0.74
96 0.69
97 0.59