Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PPE4

Protein Details
Accession N1PPE4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-172EHTRHREPERPSKRGRKLAQRKCQEPIBasic
NLS Segment(s)
PositionSequence
148-166TRHREPERPSKRGRKLAQR
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MGRLAKQPASFAGCPTATTSAPGLIAIPTASQGTDGIQVNYVPEKYHKNKSPDGSECCELRCCFCDGAYSISKRRFLSNAQGFGQHTETCHKGYLNGRGMTDREVIYRCKLRVLSLEAVQKMERSRKESVIEVKHVQGLPKDVRGEHTRHREPERPSKRGRKLAQRKCQEPILRDRRHDPPETDDSEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.2
5 0.21
6 0.2
7 0.16
8 0.16
9 0.15
10 0.13
11 0.09
12 0.1
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.07
20 0.07
21 0.12
22 0.13
23 0.12
24 0.13
25 0.13
26 0.14
27 0.16
28 0.15
29 0.11
30 0.14
31 0.22
32 0.27
33 0.37
34 0.43
35 0.47
36 0.53
37 0.58
38 0.63
39 0.62
40 0.62
41 0.57
42 0.53
43 0.48
44 0.43
45 0.41
46 0.33
47 0.28
48 0.24
49 0.21
50 0.18
51 0.18
52 0.19
53 0.16
54 0.2
55 0.22
56 0.24
57 0.26
58 0.29
59 0.33
60 0.31
61 0.32
62 0.3
63 0.28
64 0.35
65 0.37
66 0.37
67 0.34
68 0.35
69 0.33
70 0.33
71 0.32
72 0.21
73 0.16
74 0.14
75 0.15
76 0.14
77 0.14
78 0.13
79 0.14
80 0.17
81 0.24
82 0.28
83 0.27
84 0.27
85 0.27
86 0.28
87 0.26
88 0.25
89 0.17
90 0.13
91 0.13
92 0.14
93 0.17
94 0.21
95 0.19
96 0.21
97 0.21
98 0.2
99 0.22
100 0.26
101 0.26
102 0.26
103 0.3
104 0.27
105 0.28
106 0.27
107 0.25
108 0.22
109 0.26
110 0.25
111 0.25
112 0.28
113 0.31
114 0.33
115 0.37
116 0.42
117 0.41
118 0.42
119 0.4
120 0.37
121 0.38
122 0.36
123 0.33
124 0.26
125 0.26
126 0.24
127 0.26
128 0.27
129 0.23
130 0.27
131 0.3
132 0.34
133 0.37
134 0.45
135 0.47
136 0.52
137 0.59
138 0.61
139 0.64
140 0.7
141 0.71
142 0.69
143 0.72
144 0.76
145 0.79
146 0.82
147 0.83
148 0.83
149 0.85
150 0.88
151 0.88
152 0.87
153 0.83
154 0.78
155 0.78
156 0.73
157 0.68
158 0.69
159 0.69
160 0.67
161 0.67
162 0.67
163 0.68
164 0.68
165 0.68
166 0.61
167 0.58
168 0.58