Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E247

Protein Details
Accession B0E247    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-114VVKQKETSVQPKRRGRPRKKSPVIFQEPIHydrophilic
NLS Segment(s)
PositionSequence
38-107PLRADKGKARAKTPPPVAGSSRVDKGKARARTPPTTRSSAKRTAFKPPVVKQKETSVQPKRRGRPRKKSP
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_335365  -  
Amino Acid Sequences MYCKRRKIIEKPSSDDEAIQHPNRSRSSSSDSVPLARPLRADKGKARAKTPPPVAGSSRVDKGKARARTPPTTRSSAKRTAFKPPVVKQKETSVQPKRRGRPRKKSPVIFQEPIVFDKKRFKRATARFGLKELPAVLKGTQIHMPEPCLQCSARKDSAVKNCTFRGWGTPCGPCDAAHVSSCEYYLNDERRGAVRDVIRNRLAIHAPSAISALMESIEEDTLHMRTLSAVLEAIRHRCDANLREFANAIADLCLTAEPGTLLGTVFETREEFGSWYSFVQDFVDTQGVPVPAELVDALLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.56
3 0.47
4 0.45
5 0.44
6 0.4
7 0.39
8 0.38
9 0.44
10 0.45
11 0.47
12 0.43
13 0.41
14 0.46
15 0.46
16 0.43
17 0.44
18 0.42
19 0.42
20 0.42
21 0.42
22 0.36
23 0.32
24 0.32
25 0.3
26 0.38
27 0.39
28 0.42
29 0.41
30 0.49
31 0.56
32 0.58
33 0.57
34 0.57
35 0.59
36 0.63
37 0.62
38 0.59
39 0.55
40 0.56
41 0.55
42 0.52
43 0.5
44 0.44
45 0.44
46 0.39
47 0.37
48 0.35
49 0.4
50 0.42
51 0.44
52 0.44
53 0.47
54 0.53
55 0.61
56 0.64
57 0.65
58 0.62
59 0.62
60 0.63
61 0.6
62 0.6
63 0.6
64 0.6
65 0.59
66 0.56
67 0.6
68 0.62
69 0.61
70 0.63
71 0.61
72 0.66
73 0.64
74 0.64
75 0.56
76 0.57
77 0.58
78 0.55
79 0.58
80 0.57
81 0.6
82 0.67
83 0.74
84 0.75
85 0.78
86 0.84
87 0.84
88 0.85
89 0.88
90 0.89
91 0.9
92 0.89
93 0.87
94 0.87
95 0.84
96 0.75
97 0.65
98 0.59
99 0.5
100 0.45
101 0.4
102 0.3
103 0.23
104 0.32
105 0.36
106 0.4
107 0.4
108 0.42
109 0.49
110 0.57
111 0.65
112 0.64
113 0.65
114 0.57
115 0.57
116 0.55
117 0.44
118 0.37
119 0.28
120 0.2
121 0.14
122 0.14
123 0.12
124 0.12
125 0.12
126 0.13
127 0.15
128 0.14
129 0.15
130 0.14
131 0.17
132 0.2
133 0.21
134 0.2
135 0.18
136 0.18
137 0.2
138 0.23
139 0.27
140 0.23
141 0.23
142 0.25
143 0.3
144 0.39
145 0.41
146 0.4
147 0.36
148 0.35
149 0.34
150 0.32
151 0.26
152 0.24
153 0.22
154 0.25
155 0.25
156 0.27
157 0.27
158 0.28
159 0.28
160 0.21
161 0.21
162 0.2
163 0.18
164 0.16
165 0.17
166 0.15
167 0.15
168 0.15
169 0.12
170 0.09
171 0.11
172 0.16
173 0.19
174 0.2
175 0.2
176 0.21
177 0.23
178 0.26
179 0.24
180 0.22
181 0.23
182 0.29
183 0.32
184 0.37
185 0.36
186 0.33
187 0.33
188 0.32
189 0.29
190 0.23
191 0.21
192 0.17
193 0.16
194 0.15
195 0.15
196 0.11
197 0.09
198 0.08
199 0.06
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.05
206 0.05
207 0.07
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.07
214 0.07
215 0.07
216 0.07
217 0.07
218 0.11
219 0.13
220 0.16
221 0.16
222 0.17
223 0.17
224 0.18
225 0.24
226 0.26
227 0.31
228 0.35
229 0.34
230 0.35
231 0.35
232 0.33
233 0.29
234 0.23
235 0.17
236 0.1
237 0.09
238 0.08
239 0.08
240 0.08
241 0.06
242 0.06
243 0.06
244 0.05
245 0.06
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.08
252 0.08
253 0.09
254 0.09
255 0.1
256 0.11
257 0.12
258 0.12
259 0.13
260 0.15
261 0.15
262 0.14
263 0.16
264 0.15
265 0.15
266 0.15
267 0.14
268 0.13
269 0.15
270 0.17
271 0.14
272 0.14
273 0.18
274 0.17
275 0.16
276 0.15
277 0.13
278 0.1
279 0.11
280 0.11