Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PXM5

Protein Details
Accession N1PXM5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-62ASKPKSKSGPRPPPTQHKPKPTGISKKKKPPHLRYTEKELKVBasic
NLS Segment(s)
PositionSequence
15-55SSSGSGASKPKSKSGPRPPPTQHKPKPTGISKKKKPPHLRY
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences GASKGGNKHPSKSSSSSGSGASKPKSKSGPRPPPTQHKPKPTGISKKKKPPHLRYTEKELKVPKLNGIIPSGVQKSPNAKKGKNFVDDKESMNAIMAMVMAEKEGTIESKMMRARQMEEVREAKRLEAEKRAQSKKESLEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.45
4 0.42
5 0.4
6 0.38
7 0.38
8 0.37
9 0.38
10 0.36
11 0.41
12 0.46
13 0.5
14 0.57
15 0.62
16 0.69
17 0.68
18 0.76
19 0.77
20 0.8
21 0.81
22 0.81
23 0.78
24 0.77
25 0.78
26 0.75
27 0.77
28 0.75
29 0.77
30 0.77
31 0.79
32 0.78
33 0.83
34 0.83
35 0.84
36 0.86
37 0.85
38 0.85
39 0.84
40 0.84
41 0.78
42 0.81
43 0.8
44 0.71
45 0.65
46 0.58
47 0.53
48 0.49
49 0.45
50 0.37
51 0.32
52 0.32
53 0.29
54 0.26
55 0.21
56 0.16
57 0.18
58 0.18
59 0.14
60 0.13
61 0.13
62 0.19
63 0.24
64 0.31
65 0.34
66 0.34
67 0.38
68 0.46
69 0.51
70 0.51
71 0.49
72 0.44
73 0.46
74 0.46
75 0.43
76 0.37
77 0.31
78 0.23
79 0.2
80 0.18
81 0.1
82 0.08
83 0.06
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.05
93 0.06
94 0.07
95 0.07
96 0.12
97 0.15
98 0.17
99 0.21
100 0.22
101 0.24
102 0.33
103 0.38
104 0.36
105 0.4
106 0.45
107 0.43
108 0.46
109 0.43
110 0.34
111 0.35
112 0.37
113 0.35
114 0.38
115 0.43
116 0.48
117 0.57
118 0.64
119 0.62
120 0.62
121 0.66