Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PNI5

Protein Details
Accession N1PNI5   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-146EIQTQLKQRKPRRHLSKSNIEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029032  AhpD-like  
Amino Acid Sequences MSKLSEPLKQFINAAHARPNTVPAPKNVTSIYERIASDAISKKVGLPVWLSASTAATMTMNSPESMLALYNLATSASHTDPKKYTNQPLWAAELMREIGLKCIGFNGVPRTINVLGAFYGSLPEEIQTQLKQRKPRRHLSKSNIEDILARGNGLWDSIYHPFSDKLSAKLAQSHPDLPVHIIESEYGCLFSDPPGAAGENIPNVGRALTSIIAVACLRAQSGVGPQVVSHVFGLRKAFEDGSAETEEELPGGKWVASNEGSLWLLEQVDSIVHGLGVGKGTTYAPGFESAPKAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.34
4 0.36
5 0.36
6 0.38
7 0.34
8 0.38
9 0.38
10 0.35
11 0.42
12 0.41
13 0.43
14 0.39
15 0.39
16 0.35
17 0.35
18 0.33
19 0.29
20 0.27
21 0.26
22 0.25
23 0.21
24 0.23
25 0.26
26 0.25
27 0.22
28 0.22
29 0.22
30 0.25
31 0.26
32 0.22
33 0.18
34 0.19
35 0.22
36 0.22
37 0.21
38 0.17
39 0.17
40 0.16
41 0.14
42 0.11
43 0.07
44 0.07
45 0.08
46 0.1
47 0.1
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.09
63 0.11
64 0.16
65 0.17
66 0.21
67 0.23
68 0.27
69 0.34
70 0.37
71 0.43
72 0.45
73 0.51
74 0.51
75 0.51
76 0.51
77 0.44
78 0.38
79 0.3
80 0.24
81 0.18
82 0.14
83 0.12
84 0.09
85 0.09
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.08
92 0.1
93 0.13
94 0.15
95 0.16
96 0.16
97 0.2
98 0.2
99 0.21
100 0.19
101 0.15
102 0.11
103 0.11
104 0.11
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.08
114 0.08
115 0.15
116 0.21
117 0.25
118 0.34
119 0.42
120 0.51
121 0.57
122 0.67
123 0.71
124 0.75
125 0.81
126 0.8
127 0.82
128 0.75
129 0.73
130 0.62
131 0.52
132 0.42
133 0.33
134 0.27
135 0.16
136 0.12
137 0.08
138 0.08
139 0.07
140 0.06
141 0.06
142 0.04
143 0.06
144 0.09
145 0.1
146 0.09
147 0.1
148 0.11
149 0.11
150 0.17
151 0.15
152 0.15
153 0.18
154 0.19
155 0.19
156 0.25
157 0.26
158 0.24
159 0.25
160 0.25
161 0.23
162 0.23
163 0.23
164 0.17
165 0.16
166 0.13
167 0.11
168 0.09
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.06
175 0.06
176 0.06
177 0.06
178 0.08
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.1
185 0.11
186 0.08
187 0.09
188 0.08
189 0.08
190 0.08
191 0.07
192 0.07
193 0.06
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.08
200 0.08
201 0.08
202 0.06
203 0.06
204 0.06
205 0.05
206 0.06
207 0.05
208 0.08
209 0.12
210 0.12
211 0.12
212 0.11
213 0.15
214 0.15
215 0.15
216 0.13
217 0.13
218 0.13
219 0.15
220 0.18
221 0.15
222 0.17
223 0.18
224 0.18
225 0.15
226 0.18
227 0.17
228 0.19
229 0.19
230 0.17
231 0.15
232 0.16
233 0.15
234 0.12
235 0.11
236 0.08
237 0.07
238 0.08
239 0.07
240 0.08
241 0.09
242 0.14
243 0.14
244 0.14
245 0.14
246 0.17
247 0.17
248 0.16
249 0.16
250 0.11
251 0.11
252 0.1
253 0.09
254 0.07
255 0.06
256 0.07
257 0.07
258 0.06
259 0.05
260 0.06
261 0.06
262 0.07
263 0.08
264 0.07
265 0.07
266 0.08
267 0.09
268 0.11
269 0.11
270 0.11
271 0.11
272 0.14
273 0.15
274 0.18
275 0.24