Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PV93

Protein Details
Accession N1PV93    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
86-105IKNWRRPSSRDRDKDKEQSCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MKKQAQRSISETIWRFLEATASCDTGHKSYCMALLSAQVRFITETSGARINSIHQLTCSDCFESSLRYHMAEVSGFDSQREHVVTIKNWRRPSSRDRDKDKEQSCCALVQFPIALGCQDGGITGHMVALPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.23
4 0.26
5 0.18
6 0.19
7 0.18
8 0.18
9 0.18
10 0.19
11 0.21
12 0.17
13 0.18
14 0.16
15 0.14
16 0.14
17 0.16
18 0.16
19 0.14
20 0.12
21 0.16
22 0.17
23 0.16
24 0.16
25 0.14
26 0.14
27 0.14
28 0.14
29 0.1
30 0.1
31 0.1
32 0.11
33 0.15
34 0.15
35 0.14
36 0.14
37 0.14
38 0.18
39 0.19
40 0.17
41 0.13
42 0.14
43 0.15
44 0.17
45 0.17
46 0.12
47 0.11
48 0.13
49 0.13
50 0.14
51 0.13
52 0.13
53 0.13
54 0.12
55 0.12
56 0.11
57 0.11
58 0.09
59 0.09
60 0.09
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.11
67 0.11
68 0.09
69 0.1
70 0.14
71 0.16
72 0.26
73 0.34
74 0.38
75 0.41
76 0.45
77 0.47
78 0.49
79 0.56
80 0.57
81 0.6
82 0.64
83 0.69
84 0.73
85 0.77
86 0.82
87 0.78
88 0.75
89 0.67
90 0.62
91 0.54
92 0.48
93 0.4
94 0.33
95 0.27
96 0.21
97 0.18
98 0.14
99 0.13
100 0.12
101 0.11
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.07
111 0.07