Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2WIB0

Protein Details
Accession M2WIB0    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25NREASCRPIRRDRGEKQNYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto_nucl 5.5, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences PSDQNREASCRPIRRDRGEKQNYKAISYVWGEAVFVETLHLLGGVFKSTASLAGALQRFRSCERPTRLWADAVCIDQSTKLEKNYQVELMAGNYRQAEKVLVWLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.77
4 0.79
5 0.82
6 0.82
7 0.77
8 0.76
9 0.68
10 0.6
11 0.52
12 0.41
13 0.35
14 0.29
15 0.25
16 0.18
17 0.17
18 0.14
19 0.13
20 0.14
21 0.09
22 0.07
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.04
40 0.09
41 0.1
42 0.1
43 0.12
44 0.12
45 0.13
46 0.15
47 0.21
48 0.2
49 0.27
50 0.34
51 0.38
52 0.41
53 0.46
54 0.45
55 0.42
56 0.39
57 0.34
58 0.3
59 0.26
60 0.22
61 0.17
62 0.15
63 0.14
64 0.14
65 0.15
66 0.16
67 0.17
68 0.21
69 0.25
70 0.28
71 0.31
72 0.31
73 0.26
74 0.24
75 0.23
76 0.21
77 0.21
78 0.17
79 0.16
80 0.16
81 0.16
82 0.17
83 0.17
84 0.16
85 0.13